(data stored in ACNUC7421 zone)

EMBL: CP002047.PE262

CP002047.PE262       Location/Qualifiers
FT   CDS             287867..288463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03383"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM7"
FT                   /protein_id="ADI03383.1"
FT                   /translation="MSETPTAESVPPPAPGAEEYLALDFANSAIALPGGHFIDLLGTPE
FT                   ATNRWLTERGLAPADAGVQEMCAAQLRSLREHLRSLFAARVAGLPALPAALSAVNDALS
FT                   KAPTAALLYWDEKNGPYRAAPCPTNEILDRALAALAANAADLLTGPDADRLTGCGSTPC
FT                   NRYLLRHGRRHWCSTRCGDRARAARAYARRTRPEA"
     MSETPTAESV PPPAPGAEEY LALDFANSAI ALPGGHFIDL LGTPEATNRW LTERGLAPAD        60
     AGVQEMCAAQ LRSLREHLRS LFAARVAGLP ALPAALSAVN DALSKAPTAA LLYWDEKNGP       120
     YRAAPCPTNE ILDRALAALA ANAADLLTGP DADRLTGCGS TPCNRYLLRH GRRHWCSTRC       180
     GDRARAARAY ARRTRPEA                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page