(data stored in ACNUC7421 zone)

EMBL: CP002047.PE266

CP002047.PE266       Location/Qualifiers
FT   CDS             complement(291783..293237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00266"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily
FT                   protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03387"
FT                   /db_xref="GOA:D7BWN1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN1"
FT                   /protein_id="ADI03387.1"
FT                   /translation="MACLGQFMVLLDSTIVGAALPDMQERLHTQLSGLQWIVDAYVLLV
FT                   AMLLLSGGVFADRFGRKRVFLAGVVVFTVASVVCSVAPSIGWLIAGRAVQGIGAAALSP
FT                   ASLALLAAAYPVPQERVKAIGLWAGFSGIGLAAGPLAGGILVDAFGWPAIFLVNVPIGA
FT                   VLLLAGLRVLSESRNPSAPAIDIPGTVLSVLGVGALAYGLIEGGSRGWTSPVILGSFAA
FT                   AVVILAVFVAVEARSSTPMLPLRLFRQQLFTVSNTAMVVVGFALMGSSFFFSQFFVYVQ
FT                   GSSILRAGLQTLPASLAMVIVSPYAGRLAAKYGFRIVVTTGLALAGLGLLALGFVHADT
FT                   GYGNVWWRLAVVGIGFALTMSPLTGAAIQAVSPQEGGLASGISSTTRQIGAVLGVAVLG
FT                   AIVRTRESGGASFEAGLNSAFVVAGAVTLAGAVFTGLWLVKSEPSRVPGPTAGRSPLPS
FT                   DRSQGQRGGAGPDPRGVLESTPDPRT"
     MACLGQFMVL LDSTIVGAAL PDMQERLHTQ LSGLQWIVDA YVLLVAMLLL SGGVFADRFG        60
     RKRVFLAGVV VFTVASVVCS VAPSIGWLIA GRAVQGIGAA ALSPASLALL AAAYPVPQER       120
     VKAIGLWAGF SGIGLAAGPL AGGILVDAFG WPAIFLVNVP IGAVLLLAGL RVLSESRNPS       180
     APAIDIPGTV LSVLGVGALA YGLIEGGSRG WTSPVILGSF AAAVVILAVF VAVEARSSTP       240
     MLPLRLFRQQ LFTVSNTAMV VVGFALMGSS FFFSQFFVYV QGSSILRAGL QTLPASLAMV       300
     IVSPYAGRLA AKYGFRIVVT TGLALAGLGL LALGFVHADT GYGNVWWRLA VVGIGFALTM       360
     SPLTGAAIQA VSPQEGGLAS GISSTTRQIG AVLGVAVLGA IVRTRESGGA SFEAGLNSAF       420
     VVAGAVTLAG AVFTGLWLVK SEPSRVPGPT AGRSPLPSDR SQGQRGGAGP DPRGVLESTP       480
     DPRT                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page