(data stored in ACNUC7421 zone)

EMBL: CP002047.PE268

CP002047.PE268       Location/Qualifiers
FT   CDS             complement(293900..294763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03389"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN3"
FT                   /protein_id="ADI03389.1"
FT                   /translation="MRARPAAVAAVCLVAAGCSSGGADPAGSSPARHTPRPPAPTREVR
FT                   NLVLPFDAYTLDSPQVARIAVAQDRLIGSCMARRGFQWLRLPERRTESWPNRGRYGLIE
FT                   AEPAKRYGYHPLPDPRSEAAEAWIARREEGLTPKERTAAYGRDGTSGCEKEAARELLRN
FT                   VPKVDFGRLDRISADTYERAKRHPDVVKAFARWSACMRAEGFRYPDPMAANNDHRWTGD
FT                   SPSQAEIATARADVACKRRTSLVRIWWRTEADYQERQIQQHAKWFARIRLARTRYLTNV
FT                   DAHDDA"
     MRARPAAVAA VCLVAAGCSS GGADPAGSSP ARHTPRPPAP TREVRNLVLP FDAYTLDSPQ        60
     VARIAVAQDR LIGSCMARRG FQWLRLPERR TESWPNRGRY GLIEAEPAKR YGYHPLPDPR       120
     SEAAEAWIAR REEGLTPKER TAAYGRDGTS GCEKEAAREL LRNVPKVDFG RLDRISADTY       180
     ERAKRHPDVV KAFARWSACM RAEGFRYPDP MAANNDHRWT GDSPSQAEIA TARADVACKR       240
     RTSLVRIWWR TEADYQERQI QQHAKWFARI RLARTRYLTN VDAHDDA                     287
//

If you have problems or comments...

PBIL Back to PBIL home page