(data stored in ACNUC7421 zone)

EMBL: CP002047.PE269

CP002047.PE269       Location/Qualifiers
FT   CDS             complement(294837..295247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN4"
FT                   /protein_id="ADI03390.1"
FT                   /translation="MRLGLGAGAMAVAGAFLLAPTAGASPAAPDHARGATTAAAACPAP
FT                   LHAYQYTNYTGGYKKFCKSDYKLSDNRFNNGGKVNDHIRSVKNLTRGCYWTLWTDYWNR
FT                   GRKTQMDPWSWDSNLANNRVGYKTSSLYKWCN"
     MRLGLGAGAM AVAGAFLLAP TAGASPAAPD HARGATTAAA ACPAPLHAYQ YTNYTGGYKK        60
     FCKSDYKLSD NRFNNGGKVN DHIRSVKNLT RGCYWTLWTD YWNRGRKTQM DPWSWDSNLA       120
     NNRVGYKTSS LYKWCN                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page