(data stored in ACNUC7421 zone)

EMBL: CP002047.PE27

CP002047.PE27        Location/Qualifiers
FT   CDS             23042..23524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03148"
FT                   /db_xref="GOA:D7BSX1"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX1"
FT                   /protein_id="ADI03148.1"
FT                   /translation="MPLEGEYEPSPAQWVREQVELYESSGGTQGTTLWDTGLPVVIVTM
FT                   RGAKSGRIRKIPLMRVEHEGRYAAVASKAGFPRHPVWYFNLKADPQVDLQDGPKRQGMM
FT                   ARELTGDEKAQWWERAVAAYPPYAEYQEKTNRVIPVFVLEPEHLAGPAKAPAPTRN"
     MPLEGEYEPS PAQWVREQVE LYESSGGTQG TTLWDTGLPV VIVTMRGAKS GRIRKIPLMR        60
     VEHEGRYAAV ASKAGFPRHP VWYFNLKADP QVDLQDGPKR QGMMARELTG DEKAQWWERA       120
     VAAYPPYAEY QEKTNRVIPV FVLEPEHLAG PAKAPAPTRN                             160
//

If you have problems or comments...

PBIL Back to PBIL home page