(data stored in ACNUC7421 zone)

EMBL: CP002047.PE272

CP002047.PE272       Location/Qualifiers
FT   CDS             complement(297775..298221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00272"
FT                   /product="hypothetical protein"
FT                   /note="COG1959 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03393"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN7"
FT                   /protein_id="ADI03393.1"
FT                   /translation="MGVRLTRYTDLALRAVMRLAVMDGEELLTTRLIADSMNVPYTHMA
FT                   KTIAHLQHLGVVEARRGRNGGLMLTDAGRNTRVGELIRVLEGDREAVVCEGEAPCPLAG
FT                   ACRLRRALRDAQEAFYASLDQVTVADLVASPAGPVLLTLGSAPG"
     MGVRLTRYTD LALRAVMRLA VMDGEELLTT RLIADSMNVP YTHMAKTIAH LQHLGVVEAR        60
     RGRNGGLMLT DAGRNTRVGE LIRVLEGDRE AVVCEGEAPC PLAGACRLRR ALRDAQEAFY       120
     ASLDQVTVAD LVASPAGPVL LTLGSAPG                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page