(data stored in ACNUC7421 zone)

EMBL: CP002047.PE274

CP002047.PE274       Location/Qualifiers
FT   CDS             299745..300683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00274"
FT                   /product="binding-protein dependent transport protein"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03395"
FT                   /db_xref="GOA:D7BWN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN9"
FT                   /protein_id="ADI03395.1"
FT                   /translation="MTTLTSTPGGATIRHPAPPSATTGSRTPRQGGTILAVPALIWYAI
FT                   FMIGPVIAIFVIAALHWPGMLQPVSFAGLDNVRTVFDDPVFWDAVNNTAVQLAVALPIM
FT                   IVCAYMLGYYVAQKPPGHRVIRYLLFIPGLISTPAKAMVFYAALSPDGLVNGGLQSVGL
FT                   GSLTDAWLASPSTALACLIALDIWSGIGFTAVLFAARLDSVPDELGEAAQLDGAGHWRT
FT                   MWRVHFPVIRDYVGVVTMLQFLWTLFGSAQHVLLLTQGGPGSSSTTLSFLVYQKAFIAA
FT                   DLGYSQTVGVILFLAGLVGLLAIRRVFRQNY"
     MTTLTSTPGG ATIRHPAPPS ATTGSRTPRQ GGTILAVPAL IWYAIFMIGP VIAIFVIAAL        60
     HWPGMLQPVS FAGLDNVRTV FDDPVFWDAV NNTAVQLAVA LPIMIVCAYM LGYYVAQKPP       120
     GHRVIRYLLF IPGLISTPAK AMVFYAALSP DGLVNGGLQS VGLGSLTDAW LASPSTALAC       180
     LIALDIWSGI GFTAVLFAAR LDSVPDELGE AAQLDGAGHW RTMWRVHFPV IRDYVGVVTM       240
     LQFLWTLFGS AQHVLLLTQG GPGSSSTTLS FLVYQKAFIA ADLGYSQTVG VILFLAGLVG       300
     LLAIRRVFRQ NY                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page