(data stored in ACNUC7421 zone)

EMBL: CP002047.PE275

CP002047.PE275       Location/Qualifiers
FT   CDS             300698..301525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00275"
FT                   /product="binding-protein dependent transport protein"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03396"
FT                   /db_xref="GOA:D7BWP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP0"
FT                   /protein_id="ADI03396.1"
FT                   /translation="MKLSKRWLPAHLLVWTYAVLLIVPLYYFLASAFKSNEEIFAHPFA
FT                   LPDSLGFGNFRTAYDSASLGQAIVNSALVTVLALALTLLLALPASFALARSTGRLASAV
FT                   EKVFSLGFLIPTFAALFPTFLLAAATGLFHTQLFMVLFLPATAMPLSVVILVQFMRTIP
FT                   REMEEAARIDGASTYTVLRHIYTPMCLPGIATVILLNFLTFWNEYLYSLVIIGPDPDQR
FT                   TVQSALPTLKAITGTDYGVLTAGTVLTLIPVWIVYTVLQKRMQQALISGAVKM"
     MKLSKRWLPA HLLVWTYAVL LIVPLYYFLA SAFKSNEEIF AHPFALPDSL GFGNFRTAYD        60
     SASLGQAIVN SALVTVLALA LTLLLALPAS FALARSTGRL ASAVEKVFSL GFLIPTFAAL       120
     FPTFLLAAAT GLFHTQLFMV LFLPATAMPL SVVILVQFMR TIPREMEEAA RIDGASTYTV       180
     LRHIYTPMCL PGIATVILLN FLTFWNEYLY SLVIIGPDPD QRTVQSALPT LKAITGTDYG       240
     VLTAGTVLTL IPVWIVYTVL QKRMQQALIS GAVKM                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page