(data stored in ACNUC7421 zone)

EMBL: CP002047.PE277

CP002047.PE277       Location/Qualifiers
FT   CDS             302676..304619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00277"
FT                   /product="hypothetical protein"
FT                   /note="COG3934 Endo-beta-mannanase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03398"
FT                   /db_xref="GOA:D7BWP2"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP2"
FT                   /protein_id="ADI03398.1"
FT                   /translation="MRRHSAQLTHHPAVLPWLGANFWSRTGGPLMWRDYDPKTVRAELR
FT                   VLHEHGLTMTRSFFYWPDFHPQPHRIDEALCEHFRDFLDAHSETGMGTVPTFIVGHMSG
FT                   ENWDPAWRGGRDLYEDVWMVGRQAWFVSQMTRRFKDHPAVTGWLITNEMPGYGRVYQVD
FT                   PPSSEVVTAWAQAMCNAVRAAGGTQPVSLGDGAWGIEVTGRDNGFSLRETAEYVDFVGP
FT                   HVYRSDTDRPRQHLRAAFECELASVTGHPVVLEEFGLSTDTVSAENAAVYYRQTLHNSL
FT                   LGGATGWIAWNNTDYDDLWDRSPYDHHPFEMHFGITDSTGAPKTPLLELADFAKVLGDV
FT                   DFTRCRRADAGAALVVPAFLERGYPYSRPADRPLIFTSLHQSYVATRAADLPVGFTREA
FT                   DGLPGDAALYLLPATRQLTTRTRRELEHRAHEGATVYLSFCSGEHPGTRGPWFDDLDGL
FT                   FGVELQLSYGVAEPIEDVVLEMTFTDDFGGLTAGDTLRFPVAGNEDSRAYLPVLPRDAR
FT                   VVAVDAHGRPALLVRDTGRGRTVLATYPLEHMAARTARVNPEETHRLYAALADVAGVRR
FT                   PVTVDSPHVGADVLVHQDGRRFVWLVSQSPVELTVRPAADGTLHDLASGAPTADVTLAP
FT                   YGVCVLELKCWS"
     MRRHSAQLTH HPAVLPWLGA NFWSRTGGPL MWRDYDPKTV RAELRVLHEH GLTMTRSFFY        60
     WPDFHPQPHR IDEALCEHFR DFLDAHSETG MGTVPTFIVG HMSGENWDPA WRGGRDLYED       120
     VWMVGRQAWF VSQMTRRFKD HPAVTGWLIT NEMPGYGRVY QVDPPSSEVV TAWAQAMCNA       180
     VRAAGGTQPV SLGDGAWGIE VTGRDNGFSL RETAEYVDFV GPHVYRSDTD RPRQHLRAAF       240
     ECELASVTGH PVVLEEFGLS TDTVSAENAA VYYRQTLHNS LLGGATGWIA WNNTDYDDLW       300
     DRSPYDHHPF EMHFGITDST GAPKTPLLEL ADFAKVLGDV DFTRCRRADA GAALVVPAFL       360
     ERGYPYSRPA DRPLIFTSLH QSYVATRAAD LPVGFTREAD GLPGDAALYL LPATRQLTTR       420
     TRRELEHRAH EGATVYLSFC SGEHPGTRGP WFDDLDGLFG VELQLSYGVA EPIEDVVLEM       480
     TFTDDFGGLT AGDTLRFPVA GNEDSRAYLP VLPRDARVVA VDAHGRPALL VRDTGRGRTV       540
     LATYPLEHMA ARTARVNPEE THRLYAALAD VAGVRRPVTV DSPHVGADVL VHQDGRRFVW       600
     LVSQSPVELT VRPAADGTLH DLASGAPTAD VTLAPYGVCV LELKCWS                     647
//

If you have problems or comments...

PBIL Back to PBIL home page