(data stored in ACNUC7421 zone)

EMBL: CP002047.PE279

CP002047.PE279       Location/Qualifiers
FT   CDS             complement(306966..307424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00279"
FT                   /product="ROK family protein"
FT                   /note="COG1940 Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03400"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP4"
FT                   /protein_id="ADI03400.1"
FT                   /translation="MRGANGLAGELSHLHADSAGPMCRCGARGCLGVVATTDHVLEAAR
FT                   PLFGPDVNIYDVLGLAAQGEATVRRVLDDFGRLVGRHLAPACVMLNPELIVVDGTLGPA
FT                   AAPVMEGLHDGLRRHMPDGAYRALTLTLGRLAENAELLGAAHLARAPM"
     MRGANGLAGE LSHLHADSAG PMCRCGARGC LGVVATTDHV LEAARPLFGP DVNIYDVLGL        60
     AAQGEATVRR VLDDFGRLVG RHLAPACVML NPELIVVDGT LGPAAAPVME GLHDGLRRHM       120
     PDGAYRALTL TLGRLAENAE LLGAAHLARA PM                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page