(data stored in ACNUC7421 zone)

EMBL: CP002047.PE28

CP002047.PE28        Location/Qualifiers
FT   CDS             complement(24142..24480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03149"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX2"
FT                   /protein_id="ADI03149.1"
FT                   /translation="MSINRRAAVVAASLGITTGGLFLAAAPASASAQDIWTCNPPQYMT
FT                   GSGGHAGASLQCFGTSWDDAFNVAVTCKRWDNGYEYRHDGPKVQTGQVSTVWCDLNAGI
FT                   VHLAYVAW"
     MSINRRAAVV AASLGITTGG LFLAAAPASA SAQDIWTCNP PQYMTGSGGH AGASLQCFGT        60
     SWDDAFNVAV TCKRWDNGYE YRHDGPKVQT GQVSTVWCDL NAGIVHLAYV AW               112
//

If you have problems or comments...

PBIL Back to PBIL home page