(data stored in ACNUC7421 zone)

EMBL: CP002047.PE283

CP002047.PE283       Location/Qualifiers
FT   CDS             310170..311573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00283"
FT                   /product="putative transport integral membrane protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03404"
FT                   /db_xref="GOA:D7BWP8"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP8"
FT                   /protein_id="ADI03404.1"
FT                   /translation="MAQLMVVLDATIVNIALPSAQQDLGFTDGNRQWIVTAYALAFGSL
FT                   LLLGGRIADLFGRKMTFLVGLVGFAGASAFGGAATSFDMLVAARALQGVFGALLAPAAL
FT                   SLLTVTFTDARERAKAFGVYGAIAGSGGAIGLLLGGVLTEHLDWRWTLYVNLAFAVVAV
FT                   IGGAVLLQRSTRDTSVTIDIPGAVLVGGGLFCLVYGFSNAESHDWDSPATFGFLAAGAV
FT                   LLAAFTWWQTRSPHPLLPLRILLDRNRGASFVSVLISGAGMFGVFLFLTYYLQQSLGYT
FT                   PIRTGLAFLPMVAALMLTSTLATTALIPRLGPKPVVPLGMGLAAAGMAWLTALDLDSGY
FT                   AADILPPLVVAGLGLGLVMAPAMSLATSGVAAEDSGVASAAVNTMQQVGGSLGTALLNT
FT                   LSTSAVTNYLDGKNPKDPAVLAHAGLEGYSTAYWWSAVFFAAGVVISALLYRRGAPAQD
FT                   AAAAPVVHM"
     MAQLMVVLDA TIVNIALPSA QQDLGFTDGN RQWIVTAYAL AFGSLLLLGG RIADLFGRKM        60
     TFLVGLVGFA GASAFGGAAT SFDMLVAARA LQGVFGALLA PAALSLLTVT FTDARERAKA       120
     FGVYGAIAGS GGAIGLLLGG VLTEHLDWRW TLYVNLAFAV VAVIGGAVLL QRSTRDTSVT       180
     IDIPGAVLVG GGLFCLVYGF SNAESHDWDS PATFGFLAAG AVLLAAFTWW QTRSPHPLLP       240
     LRILLDRNRG ASFVSVLISG AGMFGVFLFL TYYLQQSLGY TPIRTGLAFL PMVAALMLTS       300
     TLATTALIPR LGPKPVVPLG MGLAAAGMAW LTALDLDSGY AADILPPLVV AGLGLGLVMA       360
     PAMSLATSGV AAEDSGVASA AVNTMQQVGG SLGTALLNTL STSAVTNYLD GKNPKDPAVL       420
     AHAGLEGYST AYWWSAVFFA AGVVISALLY RRGAPAQDAA AAPVVHM                     467
//

If you have problems or comments...

PBIL Back to PBIL home page