(data stored in ACNUC7421 zone)

EMBL: CP002047.PE285

CP002047.PE285       Location/Qualifiers
FT   CDS             314273..316723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00285"
FT                   /product="hypothetical protein"
FT                   /note="COG1554 Trehalose and maltose hydrolases (possible
FT                   phosphorylases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03406"
FT                   /db_xref="GOA:D7BWQ0"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ0"
FT                   /protein_id="ADI03406.1"
FT                   /translation="MSRTPPGWTWAYEGYDPAEERLRESLCTLGNGYFATRGALPECGA
FT                   DAVHSPGTYAAGCYNRLESQVAGRRVENEDLVNLPNWLPLRFRPGGEDTAGNSPTPWLS
FT                   PDTHPPLDHRLTLDLRTGILERATRYVDDAGRHLAVRQLRLVHMGDPHLAALRTEFTAE
FT                   DWSGPLEVESALDGAVANTGVARYRQLANRHLTHVHTGTAPSRDVVWLRCRTTTSDIRV
FT                   GMAARTTTDGDTDTTTTHSPERACLLLRPLMEPGRTVTVDKCVALHTSRDPAISDPLHA
FT                   AVDRVGRAPDFEALADAHRAAWEQLWRAGEMDVPGQAGRILRLHLFHLLQTLSPHTADL
FT                   DVGVPARGLHGEAYRGHVFWDELFVLPYLNLHLPEVSRALLDYRHRRLERACFAARDAG
FT                   RAGAMYPWQSGSDGREETQRLHLNPRSGRWLPDHSRLQHHVGSAIAYNVWQYGEATGDA
FT                   EFMHTKGAEMLLQIARFWADAATWDKARGRYRILGVVGPDEYHDGYPGASRPGIDDNTY
FT                   TNVTAAWVLARALDLLRSLPEPRRRDLFERTALADAELDIWQDVSRRLLVPWHRGIVSQ
FT                   FDGYGELAEFDWDRYRKAYGDIRRLDRILEAEGDTVNRYQASKQADVLMLGYLFAPAEL
FT                   RGLFRRLGHELDDTTWRRTVDYYLHRTSHGSTLSSLVHAWVLPRVRRAEAWRFCQEALT
FT                   GDIADLQGGTTGEGIHLGAMAGTLDLVQRGLTGLEPRGGVLRLDPAPLPELSRFGLSIR
FT                   YRGHWGVRLRLSAGQLHITVPASDRGPIDVALGDCTVSVPPGETCLLPLPQGADGLSMH
FT                   TAYP"
     MSRTPPGWTW AYEGYDPAEE RLRESLCTLG NGYFATRGAL PECGADAVHS PGTYAAGCYN        60
     RLESQVAGRR VENEDLVNLP NWLPLRFRPG GEDTAGNSPT PWLSPDTHPP LDHRLTLDLR       120
     TGILERATRY VDDAGRHLAV RQLRLVHMGD PHLAALRTEF TAEDWSGPLE VESALDGAVA       180
     NTGVARYRQL ANRHLTHVHT GTAPSRDVVW LRCRTTTSDI RVGMAARTTT DGDTDTTTTH       240
     SPERACLLLR PLMEPGRTVT VDKCVALHTS RDPAISDPLH AAVDRVGRAP DFEALADAHR       300
     AAWEQLWRAG EMDVPGQAGR ILRLHLFHLL QTLSPHTADL DVGVPARGLH GEAYRGHVFW       360
     DELFVLPYLN LHLPEVSRAL LDYRHRRLER ACFAARDAGR AGAMYPWQSG SDGREETQRL       420
     HLNPRSGRWL PDHSRLQHHV GSAIAYNVWQ YGEATGDAEF MHTKGAEMLL QIARFWADAA       480
     TWDKARGRYR ILGVVGPDEY HDGYPGASRP GIDDNTYTNV TAAWVLARAL DLLRSLPEPR       540
     RRDLFERTAL ADAELDIWQD VSRRLLVPWH RGIVSQFDGY GELAEFDWDR YRKAYGDIRR       600
     LDRILEAEGD TVNRYQASKQ ADVLMLGYLF APAELRGLFR RLGHELDDTT WRRTVDYYLH       660
     RTSHGSTLSS LVHAWVLPRV RRAEAWRFCQ EALTGDIADL QGGTTGEGIH LGAMAGTLDL       720
     VQRGLTGLEP RGGVLRLDPA PLPELSRFGL SIRYRGHWGV RLRLSAGQLH ITVPASDRGP       780
     IDVALGDCTV SVPPGETCLL PLPQGADGLS MHTAYP                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page