(data stored in ACNUC7421 zone)

EMBL: CP002047.PE286

CP002047.PE286       Location/Qualifiers
FT   CDS             complement(316779..317654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00286"
FT                   /product="hypothetical protein"
FT                   /note="COG0589 Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03407"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ1"
FT                   /protein_id="ADI03407.1"
FT                   /translation="MEEQVVTVGLDGSPESFAAARWAAAEAERRELALRLLHAWILLSP
FT                   PTPDSPPADDQNYWAKRIVHDARMELSRRHPDLPIEEELVAQEAETALLDAAARSRMLV
FT                   LGSRGMEPLASFFLGDISLYVVGRADRPVVLVRAGGVDEARTSGVRERDVVVGLSLHGP
FT                   QDNLLEFAYVTAFTRGVPLRAVHGRSLPVHAYVPWGVDPGIARDVAEEAQRELDEVLRP
FT                   WRKKFPRVEVVDEVRLESPAQAVVRAAGGSGLLMIGRRKHRSALAPRLGPVVQSAVHHA
FT                   RCPVAVVPHE"
     MEEQVVTVGL DGSPESFAAA RWAAAEAERR ELALRLLHAW ILLSPPTPDS PPADDQNYWA        60
     KRIVHDARME LSRRHPDLPI EEELVAQEAE TALLDAAARS RMLVLGSRGM EPLASFFLGD       120
     ISLYVVGRAD RPVVLVRAGG VDEARTSGVR ERDVVVGLSL HGPQDNLLEF AYVTAFTRGV       180
     PLRAVHGRSL PVHAYVPWGV DPGIARDVAE EAQRELDEVL RPWRKKFPRV EVVDEVRLES       240
     PAQAVVRAAG GSGLLMIGRR KHRSALAPRL GPVVQSAVHH ARCPVAVVPH E                291
//

If you have problems or comments...

PBIL Back to PBIL home page