(data stored in ACNUC7421 zone)

EMBL: CP002047.PE288

CP002047.PE288       Location/Qualifiers
FT   CDS             319173..320906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00288"
FT                   /product="amino acid permease"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03409"
FT                   /db_xref="GOA:D7BWQ3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ3"
FT                   /protein_id="ADI03409.1"
FT                   /translation="MEGLAALSLDALSSVAYGPEAIVLALVAAGSGALAATLPVTLAIV
FT                   LLLVALVVSYSQVIAVHPDGGGAYAVAKKDLGVTPSLLAAASLVVDYVLTVAVSLAAGA
FT                   DALASAFPALAHDKLVVTLAGLALLTAVNLRGVTESARVLMLPTVLFIMAIAGVIVLGL
FT                   LRPHPAAVVGTEQPLHVHEALGVVLVLKAFSSGCSALTGVEAIANAVPTFRTPRVRRAQ
FT                   RTELMLGALLGLMLIGLAVLIHRDHVAPRGEVTILAQLTAGAYGDGWAYYATNLIVTLI
FT                   LLLAANTSFGGLPVLMSLLARDHRLPHLFGLRAERPVYRYGVVALALLAAVLLIAVDAD
FT                   THRLIPLFAIGVFIGFTLSQVGLVRHWATDQPDGWLPRALINGTGALLTTLAGVILLTT
FT                   KFLEGAWVVVIAVPLLMLLFARIQRYYTEVGKELELGRVPAAPDRRAASLVIVPLGEVS
FT                   KLARHAISAALALGDEVVAVAVQADPDRTRALRDAWERWNPGVRLDVIDSPHRSLVQPI
FT                   VDYVQRAAQDGRQIAVLIPEVEPRHRRYEILQNQRGLLLATVLRARTDVVVCMLPYRLS
FT                   M"
     MEGLAALSLD ALSSVAYGPE AIVLALVAAG SGALAATLPV TLAIVLLLVA LVVSYSQVIA        60
     VHPDGGGAYA VAKKDLGVTP SLLAAASLVV DYVLTVAVSL AAGADALASA FPALAHDKLV       120
     VTLAGLALLT AVNLRGVTES ARVLMLPTVL FIMAIAGVIV LGLLRPHPAA VVGTEQPLHV       180
     HEALGVVLVL KAFSSGCSAL TGVEAIANAV PTFRTPRVRR AQRTELMLGA LLGLMLIGLA       240
     VLIHRDHVAP RGEVTILAQL TAGAYGDGWA YYATNLIVTL ILLLAANTSF GGLPVLMSLL       300
     ARDHRLPHLF GLRAERPVYR YGVVALALLA AVLLIAVDAD THRLIPLFAI GVFIGFTLSQ       360
     VGLVRHWATD QPDGWLPRAL INGTGALLTT LAGVILLTTK FLEGAWVVVI AVPLLMLLFA       420
     RIQRYYTEVG KELELGRVPA APDRRAASLV IVPLGEVSKL ARHAISAALA LGDEVVAVAV       480
     QADPDRTRAL RDAWERWNPG VRLDVIDSPH RSLVQPIVDY VQRAAQDGRQ IAVLIPEVEP       540
     RHRRYEILQN QRGLLLATVL RARTDVVVCM LPYRLSM                                577
//

If you have problems or comments...

PBIL Back to PBIL home page