(data stored in ACNUC7421 zone)

EMBL: CP002047.PE29

CP002047.PE29        Location/Qualifiers
FT   CDS             complement(24979..27909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00029"
FT                   /product="TPR repeat-containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03150"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX3"
FT                   /protein_id="ADI03150.1"
FT                   /translation="MVDGSSGVDSGYQAHRAAFAVFAEQLRKGDRRAALAAAHAVHDQV
FT                   LAARHLNLRGVALNCVGLAQFELGEFAAAVESHQRAKDLSRRSDVRGFAALRANLARIA
FT                   AGESVAYPQVWEADSAPGQLAALARSEHPHLAPAAGVELGRLLCGEQHFLAAIRAYWAV
FT                   VDSGHPWFRPRAAAPLAKLLREAGDHEGASRVLDYASPEADAPDLVDLALAPLDDPEEP
FT                   PFWLAPVRSGLGHYRAGDLTAARAELRAVAAGDWRHAAHQAGTVLAGIELRHGDLTAAR
FT                   QLLGDLAETADFTHGPRAAVALAILDAAEAAPPDTTTTVGPVSALARYLTRDQDVLADL
FT                   EALAQGRHPLAGVFAALLGDLLDDGRPGSGAAHWQDRAVQSKDRLAVGYTAYLTATNLT
FT                   MWDNTERVVDALAEACESAPAVLPWAAVRLGEANLADSYGSGDSQSFFQGVLDTGHRAL
FT                   VPRAAAGLFNSSPADSWSAEERYELAEELLTGDLPAEAVPPLAWLAAEKLITYEDDLDG
FT                   GREALERIPESDPEFGAPALAVRLLLDEEADGMRAVFERLARWDDRSLEMASECCMSVL
FT                   WKLPDESAVTRRALLVLADLGDQSAPLAHKVWERLIKVCQIQHDLDGELAAREASNLRL
FT                   DRHPGSGVLEAARRFYLDGDLDQAVELYQRVSTEEFPEARSKAAVDLGVLLRHQGRHEE
FT                   AQELPAADVHPQYCFRLGTDLEGAGRIDEAILAWELIADTDDITWAVRAHYYLGKAHAD
FT                   RGEFDAAIAAYQRAGATEDSSFRGRAWYELGCLYQDQGNLALAKEAQQRGADVAARLGK
FT                   DGETVLGGCKLRLAQLSTLSGETEDARRRYLDMVDNADRGTAAMGAMMLGGDAKDRRDV
FT                   AEAQRWYQWVIDSGDLFQRQLALAHLGELYYWVGDRDQSREFYQRTLDSTRSNPDLVAE
FT                   AAYRLGEMAGEDGDTDQAVRYLERARDTGDATFGPQASQLLGRLTG"
     MVDGSSGVDS GYQAHRAAFA VFAEQLRKGD RRAALAAAHA VHDQVLAARH LNLRGVALNC        60
     VGLAQFELGE FAAAVESHQR AKDLSRRSDV RGFAALRANL ARIAAGESVA YPQVWEADSA       120
     PGQLAALARS EHPHLAPAAG VELGRLLCGE QHFLAAIRAY WAVVDSGHPW FRPRAAAPLA       180
     KLLREAGDHE GASRVLDYAS PEADAPDLVD LALAPLDDPE EPPFWLAPVR SGLGHYRAGD       240
     LTAARAELRA VAAGDWRHAA HQAGTVLAGI ELRHGDLTAA RQLLGDLAET ADFTHGPRAA       300
     VALAILDAAE AAPPDTTTTV GPVSALARYL TRDQDVLADL EALAQGRHPL AGVFAALLGD       360
     LLDDGRPGSG AAHWQDRAVQ SKDRLAVGYT AYLTATNLTM WDNTERVVDA LAEACESAPA       420
     VLPWAAVRLG EANLADSYGS GDSQSFFQGV LDTGHRALVP RAAAGLFNSS PADSWSAEER       480
     YELAEELLTG DLPAEAVPPL AWLAAEKLIT YEDDLDGGRE ALERIPESDP EFGAPALAVR       540
     LLLDEEADGM RAVFERLARW DDRSLEMASE CCMSVLWKLP DESAVTRRAL LVLADLGDQS       600
     APLAHKVWER LIKVCQIQHD LDGELAAREA SNLRLDRHPG SGVLEAARRF YLDGDLDQAV       660
     ELYQRVSTEE FPEARSKAAV DLGVLLRHQG RHEEAQELPA ADVHPQYCFR LGTDLEGAGR       720
     IDEAILAWEL IADTDDITWA VRAHYYLGKA HADRGEFDAA IAAYQRAGAT EDSSFRGRAW       780
     YELGCLYQDQ GNLALAKEAQ QRGADVAARL GKDGETVLGG CKLRLAQLST LSGETEDARR       840
     RYLDMVDNAD RGTAAMGAMM LGGDAKDRRD VAEAQRWYQW VIDSGDLFQR QLALAHLGEL       900
     YYWVGDRDQS REFYQRTLDS TRSNPDLVAE AAYRLGEMAG EDGDTDQAVR YLERARDTGD       960
     ATFGPQASQL LGRLTG                                                       976
//

If you have problems or comments...

PBIL Back to PBIL home page