(data stored in ACNUC7421 zone)

EMBL: CP002047.PE290

CP002047.PE290       Location/Qualifiers
FT   CDS             322119..322640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03411"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ5"
FT                   /protein_id="ADI03411.1"
FT                   /translation="MSGSLGSHTALYLAAAEARRRGAELWPVLAWEPPGGELAANRTAA
FT                   TSPSALDWRRLARERLLTALDDVFGAAGPGVQLHALVACGAPGRALVGIADRENDVLVV
FT                   GAGRRGGLRRALRRSVSRYCLAHAACPVLAVPPSPLEAELTAVHRRNAWRLRLDTRDLG
FT                   DAAKTVPPDA"
     MSGSLGSHTA LYLAAAEARR RGAELWPVLA WEPPGGELAA NRTAATSPSA LDWRRLARER        60
     LLTALDDVFG AAGPGVQLHA LVACGAPGRA LVGIADREND VLVVGAGRRG GLRRALRRSV       120
     SRYCLAHAAC PVLAVPPSPL EAELTAVHRR NAWRLRLDTR DLGDAAKTVP PDA              173
//

If you have problems or comments...

PBIL Back to PBIL home page