(data stored in ACNUC7421 zone)

EMBL: CP002047.PE291

CP002047.PE291       Location/Qualifiers
FT   CDS             complement(322661..325210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00291"
FT                   /product="two-component system sensor kinase for
FT                   high-affinity potassium transport system"
FT                   /note="COG2205 Osmosensitive K+ channel histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03412"
FT                   /db_xref="GOA:D7BWQ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ6"
FT                   /protein_id="ADI03412.1"
FT                   /translation="MARGKFRIYLGAAPGVGKTYSMLSEAHRRVERGTDCVVAFVEHHH
FT                   RPRTEVMLHGLEQMPRKELEYRGGTFTEMDVDAVLARRPQVVLVDELAHTNVPGSRNAK
FT                   RWQDVEELLAAGIDVISTVNIQHLESLGDVVESITGIRQQETVPDEVVRRADQVELVDM
FT                   SPEALRRRMAHGNIYKPDKVDAALSNYFRPGNLTALRELALLWVADRVDEYLTEYRSEH
FT                   KVRAIWGSRERIVVGLTGGPEGRTLIRRAARLAEKGAGGEVMAVYIARSDGLASTSNSP
FT                   KELAVQRTLVEDLGGTFHHVVGDDVSAGLLDFARAVNATQIVLGVSRRKGWQYVFGPGV
FT                   GATVARESGPDLDVHLITHDEAGKGRGLPVARGARLGRTRIIGGWLAGVLGPALLTLLL
FT                   NGVVPEMGLANDMLLFLAMTVAAALLGGLLPALASAVVGSLLLNWFFTPPVHTLTIADP
FT                   KNIVAIAVFIGVAVSVASVVDLAARRTHQASRLRAESEILSFLTGNVLRGETSLDALLE
FT                   RVRETFGMESVALLERHSDVDPWTCAGSVGADPAQCPEDADVDVPVSEHMALALSGRVL
FT                   PAADRRVLAAFAAQAAVVLDRQRLQGEADQAKDLAEGNRIRTALLAAVSHDLRTPLAGI
FT                   KAAVSSLRSEDVAWSEEDQAELLEAIEEGADRLDLLVGNLLDMSRLQTGTVTPVIREAD
FT                   LDEVVPMALGGVPEGSVELDIPETLPMVHVDKGLLERAVANVVENAVKHSPPDRRVLVS
FT                   ASAMADRVEVRVVDRGPGVPDEAKDRIFEPFQRYGDSPRGTGVGLGLAVARGFVEAQGG
FT                   TLHAEDTPGGGLTMVLSVRTAPERRPEQPSLPAAATS"
     MARGKFRIYL GAAPGVGKTY SMLSEAHRRV ERGTDCVVAF VEHHHRPRTE VMLHGLEQMP        60
     RKELEYRGGT FTEMDVDAVL ARRPQVVLVD ELAHTNVPGS RNAKRWQDVE ELLAAGIDVI       120
     STVNIQHLES LGDVVESITG IRQQETVPDE VVRRADQVEL VDMSPEALRR RMAHGNIYKP       180
     DKVDAALSNY FRPGNLTALR ELALLWVADR VDEYLTEYRS EHKVRAIWGS RERIVVGLTG       240
     GPEGRTLIRR AARLAEKGAG GEVMAVYIAR SDGLASTSNS PKELAVQRTL VEDLGGTFHH       300
     VVGDDVSAGL LDFARAVNAT QIVLGVSRRK GWQYVFGPGV GATVARESGP DLDVHLITHD       360
     EAGKGRGLPV ARGARLGRTR IIGGWLAGVL GPALLTLLLN GVVPEMGLAN DMLLFLAMTV       420
     AAALLGGLLP ALASAVVGSL LLNWFFTPPV HTLTIADPKN IVAIAVFIGV AVSVASVVDL       480
     AARRTHQASR LRAESEILSF LTGNVLRGET SLDALLERVR ETFGMESVAL LERHSDVDPW       540
     TCAGSVGADP AQCPEDADVD VPVSEHMALA LSGRVLPAAD RRVLAAFAAQ AAVVLDRQRL       600
     QGEADQAKDL AEGNRIRTAL LAAVSHDLRT PLAGIKAAVS SLRSEDVAWS EEDQAELLEA       660
     IEEGADRLDL LVGNLLDMSR LQTGTVTPVI READLDEVVP MALGGVPEGS VELDIPETLP       720
     MVHVDKGLLE RAVANVVENA VKHSPPDRRV LVSASAMADR VEVRVVDRGP GVPDEAKDRI       780
     FEPFQRYGDS PRGTGVGLGL AVARGFVEAQ GGTLHAEDTP GGGLTMVLSV RTAPERRPEQ       840
     PSLPAAATS                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page