(data stored in ACNUC7421 zone)

EMBL: CP002047.PE292

CP002047.PE292       Location/Qualifiers
FT   CDS             complement(325271..325954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00292"
FT                   /product="putative two-component system response regulator"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03413"
FT                   /db_xref="GOA:D7BWQ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ7"
FT                   /protein_id="ADI03413.1"
FT                   /translation="MTRVLVVEDDPQLVRALVINLQARHYDVDAAPDGTTALRLAASHQ
FT                   PDVVVLDLGLPDMDGVDVIKALRGWTPVPVLVLSARRASEEKVAALDAGADDYMTKPFS
FT                   MDELLARLRASVRRTEAGPTAPETTLVKTDDFTVDLTAKKAHRDGRDVHLTPTEWHLLE
FT                   ILVTNPGRLVTQRHLLQEVWGASQSNKTNYLRVYMAQLRRKLEADPSHPRYLITEPGMG
FT                   YRFEE"
     MTRVLVVEDD PQLVRALVIN LQARHYDVDA APDGTTALRL AASHQPDVVV LDLGLPDMDG        60
     VDVIKALRGW TPVPVLVLSA RRASEEKVAA LDAGADDYMT KPFSMDELLA RLRASVRRTE       120
     AGPTAPETTL VKTDDFTVDL TAKKAHRDGR DVHLTPTEWH LLEILVTNPG RLVTQRHLLQ       180
     EVWGASQSNK TNYLRVYMAQ LRRKLEADPS HPRYLITEPG MGYRFEE                     227
//

If you have problems or comments...

PBIL Back to PBIL home page