(data stored in ACNUC7421 zone)

EMBL: CP002047.PE293

CP002047.PE293       Location/Qualifiers
FT   CDS             complement(326079..326747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00293"
FT                   /product="potassium-transporting ATPase subunit C"
FT                   /EC_number="3.6.3.12"
FT                   /note="COG2156 K+-transporting ATPase, c chain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03414"
FT                   /db_xref="GOA:D7BWQ8"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ8"
FT                   /protein_id="ADI03414.1"
FT                   /translation="MNNSLTNTARLLGAGLRALLVLTLVTGVIYPLVITGIAQGLFSDK
FT                   ANGSEIKADGKVVGSSLIGQSYNLPLKKGQETPDPDLKWFQGRPQNGLGSNSVNTQYKL
FT                   ILSGATNRSGDNEDLIQWVNDAQTAVADVNSVPGYKVERSDVPADAVTSSGSGLDPHIS
FT                   RDYADLQVHRVAQQNKLSVSQVQKLVNDHVEGRTLGFIGEPRVNVLELNIALKAVMAKS
FT                   "
     MNNSLTNTAR LLGAGLRALL VLTLVTGVIY PLVITGIAQG LFSDKANGSE IKADGKVVGS        60
     SLIGQSYNLP LKKGQETPDP DLKWFQGRPQ NGLGSNSVNT QYKLILSGAT NRSGDNEDLI       120
     QWVNDAQTAV ADVNSVPGYK VERSDVPADA VTSSGSGLDP HISRDYADLQ VHRVAQQNKL       180
     SVSQVQKLVN DHVEGRTLGF IGEPRVNVLE LNIALKAVMA KS                          222
//

If you have problems or comments...

PBIL Back to PBIL home page