(data stored in ACNUC7421 zone)

EMBL: CP002047.PE294

CP002047.PE294       Location/Qualifiers
FT   CDS             complement(326753..328885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00294"
FT                   /product="potassium-transporting ATPase subunit B"
FT                   /EC_number="3.6.3.12"
FT                   /note="COG2216 High-affinity K+ transport system, ATPase
FT                   chain B"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03415"
FT                   /db_xref="GOA:D7BWQ9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWQ9"
FT                   /protein_id="ADI03415.1"
FT                   /translation="MTTDMKKHEEPMSTATPTRAPHSDVPTGHRPAEGRVGAGLFDPGQ
FT                   LLKSLPDAFRKLDPRVMVKSPVMFVVLVGSVLTTIFSFKDPTDWFGWAISAWLWLTVIF
FT                   ANLAEAVAEGRGKAQADTLRKAKTDTVARRLSGAAEERVPGTELKIGDLVVCEAGDIIP
FT                   GDGDVVEGVASVDESAITGESAPVIRESGGDRSAVTGGTKVLSDRIVIKITTKPGETFI
FT                   DRMINLVEGAARQKTPNEIALNILLASLTIVFLLACATLPPFAEYAHKHLTMVVLVALL
FT                   VCLIPTTIGALLSAIGIAGMDRLVQRNVLAMSGRAVEAAGDVSTLLLDKTGTITLGNRQ
FT                   ASEFVPVRGTTEAEVADAAQLSSLADETPEGRSIVVLAKEKYGLRERHQGELADAEWVA
FT                   FTAQTRMSGVDVDGRKVRKGAAGSVIAWVQQQGGTVAQDADEIANRISEAGGTPLLVAV
FT                   HDDQGARILGVIHLKDVVKEGMRERFDELRRMGIKTVMITGDNPLTAKAIAEEAGVDDF
FT                   LAEATPEDKMALIKREQAGGKLVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGNMV
FT                   DLDSNPTKLIEIVEIGKQLLITRGALTTFSIANDVAKYFAIIPALFAAVYPGLDKLNIM
FT                   GLSSPDSAILSAVIFNALIIIALVPLALRGVQYRPVSADKMLRRNLTIYGLGGLVAPFV
FT                   GIKIIDLLISLIPGIG"
     MTTDMKKHEE PMSTATPTRA PHSDVPTGHR PAEGRVGAGL FDPGQLLKSL PDAFRKLDPR        60
     VMVKSPVMFV VLVGSVLTTI FSFKDPTDWF GWAISAWLWL TVIFANLAEA VAEGRGKAQA       120
     DTLRKAKTDT VARRLSGAAE ERVPGTELKI GDLVVCEAGD IIPGDGDVVE GVASVDESAI       180
     TGESAPVIRE SGGDRSAVTG GTKVLSDRIV IKITTKPGET FIDRMINLVE GAARQKTPNE       240
     IALNILLASL TIVFLLACAT LPPFAEYAHK HLTMVVLVAL LVCLIPTTIG ALLSAIGIAG       300
     MDRLVQRNVL AMSGRAVEAA GDVSTLLLDK TGTITLGNRQ ASEFVPVRGT TEAEVADAAQ       360
     LSSLADETPE GRSIVVLAKE KYGLRERHQG ELADAEWVAF TAQTRMSGVD VDGRKVRKGA       420
     AGSVIAWVQQ QGGTVAQDAD EIANRISEAG GTPLLVAVHD DQGARILGVI HLKDVVKEGM       480
     RERFDELRRM GIKTVMITGD NPLTAKAIAE EAGVDDFLAE ATPEDKMALI KREQAGGKLV       540
     AMTGDGTNDA PALAQADVGV AMNTGTSAAK EAGNMVDLDS NPTKLIEIVE IGKQLLITRG       600
     ALTTFSIAND VAKYFAIIPA LFAAVYPGLD KLNIMGLSSP DSAILSAVIF NALIIIALVP       660
     LALRGVQYRP VSADKMLRRN LTIYGLGGLV APFVGIKIID LLISLIPGIG                  710
//

If you have problems or comments...

PBIL Back to PBIL home page