(data stored in ACNUC7421 zone)

EMBL: CP002047.PE295

CP002047.PE295       Location/Qualifiers
FT   CDS             complement(328882..330546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00295"
FT                   /product="potassium-transporting ATPase subunit A"
FT                   /EC_number="3.6.3.12"
FT                   /note="COG2060 K+-transporting ATPase, A chain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03416"
FT                   /db_xref="GOA:D7BWR0"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR0"
FT                   /protein_id="ADI03416.1"
FT                   /translation="MSPVLAGVLQLLALIAALALVYVPLGNYMAGVYSSDKHWRVEKWI
FT                   YKGIGANPDTEMRWPAYLRGVLAFSAVGVLFLYLLQRVQGALPGSLGFASIDPDQAFNT
FT                   AASFVTNTNWQSYYGEQAMGHVVQTAGLAVQNFVSAAVGIAVAVALVRGFARARTGELG
FT                   NFWADLVRGTVRILVPVAAIAAVVLVACGAIQNFSGIHEVGQFMGGSQQWNGGAVASTE
FT                   AIKEVGTNGGGIFNANSAHPFENPIPFTNLFEIFLILVIPLSLTRTFGVLVGSVKQGYA
FT                   ILATMATIWIGFTALMMWTEFSHHGPAFEIAGGAMEGKEVRFGVGGSSIFAVATTLTST
FT                   GAVDSFHSSFTGLGGGITMLGMMLGEIAPGGVGSGLYGMLIMAIIAVFIAGLMVGRTPE
FT                   YLGKKIGTREIKLAAMYILVTPALVLIFTAAAMALPTPQNSMTNSGAHGFSEILYAYTS
FT                   GANNNGSAFAGLNADTQWFNTTIGLAMLLGRFVPMVFVLALAGSLAEQKPVPATAGTLR
FT                   TEKPLFTGLLVGAILIITGLTYFPALALGPLAEGMAS"
     MSPVLAGVLQ LLALIAALAL VYVPLGNYMA GVYSSDKHWR VEKWIYKGIG ANPDTEMRWP        60
     AYLRGVLAFS AVGVLFLYLL QRVQGALPGS LGFASIDPDQ AFNTAASFVT NTNWQSYYGE       120
     QAMGHVVQTA GLAVQNFVSA AVGIAVAVAL VRGFARARTG ELGNFWADLV RGTVRILVPV       180
     AAIAAVVLVA CGAIQNFSGI HEVGQFMGGS QQWNGGAVAS TEAIKEVGTN GGGIFNANSA       240
     HPFENPIPFT NLFEIFLILV IPLSLTRTFG VLVGSVKQGY AILATMATIW IGFTALMMWT       300
     EFSHHGPAFE IAGGAMEGKE VRFGVGGSSI FAVATTLTST GAVDSFHSSF TGLGGGITML       360
     GMMLGEIAPG GVGSGLYGML IMAIIAVFIA GLMVGRTPEY LGKKIGTREI KLAAMYILVT       420
     PALVLIFTAA AMALPTPQNS MTNSGAHGFS EILYAYTSGA NNNGSAFAGL NADTQWFNTT       480
     IGLAMLLGRF VPMVFVLALA GSLAEQKPVP ATAGTLRTEK PLFTGLLVGA ILIITGLTYF       540
     PALALGPLAE GMAS                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page