(data stored in ACNUC7421 zone)

EMBL: CP002047.PE296

CP002047.PE296       Location/Qualifiers
FT   CDS             complement(330868..332709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00296"
FT                   /product="putative aminoacid/polyamine transporter,
FT                   permease protein"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03417"
FT                   /db_xref="GOA:D7BWR1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR1"
FT                   /protein_id="ADI03417.1"
FT                   /translation="MSVLTTEPGATPADEEPPDTGERHRLTAVTGLAALSLDAMASVAY
FT                   GPEAIVLVLAAAGAHGLGFTLPVTLAIAGLLAVLVASYRQVIAAFPDGGGSYAVARTHL
FT                   GRRTSLVAAASLVLDYVLNVAVAVTAGVAALTSAFPALYDDRLWLCLAVLVLITGVNLR
FT                   GIVESARAFIVPTVVFVCSILVLIVIGLFRSAPVSTEAAAGHVSVLADNATTVGALLLL
FT                   KAFASGCSALTGVEAIANAVPSFRVPRVKRAQLAEVALGAVLGVMLIGLSVLISRFHLQ
FT                   PVEGVTVLAQLADASLGHNWGFYVIQFATMILLALSANTSFGGLPVLLKLLARDNYLPH
FT                   VFALKADRQVHRHGVLALALVSAGLLVFSGGDTNTLVPLFAIGVFVGFTIAQVGMVRHW
FT                   RGERGARWRGKAVLNGLGAVLTGVSAVVVTATKFQEGAWLIVIALPLFVVAFETVHRAY
FT                   ARIGERLGLGRIPEPPHRDRSVVIVPVSGLSRLTCEALNAAASLGDEVRAVTVCYPDAE
FT                   DRAQTHALERAWAEWNPGVPLIPLASERRTLGRPIAAYVRETAAAEPGTRVTVLIPEVE
FT                   PERLWQRLLQNQRGAVVAHAVRRETRAVICRLRFRLS"
     MSVLTTEPGA TPADEEPPDT GERHRLTAVT GLAALSLDAM ASVAYGPEAI VLVLAAAGAH        60
     GLGFTLPVTL AIAGLLAVLV ASYRQVIAAF PDGGGSYAVA RTHLGRRTSL VAAASLVLDY       120
     VLNVAVAVTA GVAALTSAFP ALYDDRLWLC LAVLVLITGV NLRGIVESAR AFIVPTVVFV       180
     CSILVLIVIG LFRSAPVSTE AAAGHVSVLA DNATTVGALL LLKAFASGCS ALTGVEAIAN       240
     AVPSFRVPRV KRAQLAEVAL GAVLGVMLIG LSVLISRFHL QPVEGVTVLA QLADASLGHN       300
     WGFYVIQFAT MILLALSANT SFGGLPVLLK LLARDNYLPH VFALKADRQV HRHGVLALAL       360
     VSAGLLVFSG GDTNTLVPLF AIGVFVGFTI AQVGMVRHWR GERGARWRGK AVLNGLGAVL       420
     TGVSAVVVTA TKFQEGAWLI VIALPLFVVA FETVHRAYAR IGERLGLGRI PEPPHRDRSV       480
     VIVPVSGLSR LTCEALNAAA SLGDEVRAVT VCYPDAEDRA QTHALERAWA EWNPGVPLIP       540
     LASERRTLGR PIAAYVRETA AAEPGTRVTV LIPEVEPERL WQRLLQNQRG AVVAHAVRRE       600
     TRAVICRLRF RLS                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page