(data stored in ACNUC7421 zone)

EMBL: CP002047.PE297

CP002047.PE297       Location/Qualifiers
FT   CDS             complement(332977..335448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00297"
FT                   /product="Osmosensitive K channel His kinase sensor"
FT                   /note="COG2205 Osmosensitive K+ channel histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03418"
FT                   /db_xref="GOA:D7BWR2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR2"
FT                   /protein_id="ADI03418.1"
FT                   /translation="MNDVRPGRLKVYLGAAPGVGKTYRMLDEGRRRASRGADVVVGFVE
FT                   CHGRPRTEAMLDGLEVVPRAHCDYRGGKFQEMDLAAVLARRPQVAIVDEFAHSNVPGGH
FT                   NSKRWQDVEELLAAGVDVITAVNIQHLASLNDVVEKITRVPQGETVPDEVVRRAQQIEL
FT                   VDMEPEGLRRRMAHGNIYAPEKVDAALANYFRPGNLTALRQLALLWVADQVDEALQMYR
FT                   TEHGIGRVWETRERVVVALTGGLEGDTLIRRAARIADRSAGGDLLAVHVTRSDGLAVGS
FT                   SHASLARQRRLVEDLGGSYHSVVGDDVGTALVEFARAEHATQLVLGTSRRGRIERFLGG
FT                   CGTGETVVGMSGDIDVHMVTHERAGRGMLLPSRRRTLSLVRRVAGPVAGLVLPVLLTVL
FT                   LDRARGTFNLTSEALLFLLTVVGVACIGGVASAVIASVTASLLLNYWFIPPIGAFTLDN
FT                   ADALVALGVFAIVAATVAGVVDRSLRLSRRSARATAEAETMSSLAGTIVRGGATIPALL
FT                   ERTRETFGMESADLVHHEQTPDEEGVTVVPAGPGAFLVLRGRTLPSSGRRVLAAFAAHV
FT                   GSAVERTRLAEAAAEIEPVKAADRMRTALLRAVGHDLRTPLAAGWAAVTSLRSRDVEFS
FT                   DEDRDELLATADESLAKLNRLVENLLDLSRLQAGVLTLDLRATTLEEVLPAALADIPDV
FT                   EVRDLEEIPAVMADPPLLERVIANLVGNAARHSPPGGQVALTASAHAGRVEVRVVDRGP
FT                   GLPQTGRERIFEPFQRLGDTDNTTGLGLGLALSKGLTEAMDGTLVPEDTPGGGLTMVLS
FT                   LPFAERTVYSR"
     MNDVRPGRLK VYLGAAPGVG KTYRMLDEGR RRASRGADVV VGFVECHGRP RTEAMLDGLE        60
     VVPRAHCDYR GGKFQEMDLA AVLARRPQVA IVDEFAHSNV PGGHNSKRWQ DVEELLAAGV       120
     DVITAVNIQH LASLNDVVEK ITRVPQGETV PDEVVRRAQQ IELVDMEPEG LRRRMAHGNI       180
     YAPEKVDAAL ANYFRPGNLT ALRQLALLWV ADQVDEALQM YRTEHGIGRV WETRERVVVA       240
     LTGGLEGDTL IRRAARIADR SAGGDLLAVH VTRSDGLAVG SSHASLARQR RLVEDLGGSY       300
     HSVVGDDVGT ALVEFARAEH ATQLVLGTSR RGRIERFLGG CGTGETVVGM SGDIDVHMVT       360
     HERAGRGMLL PSRRRTLSLV RRVAGPVAGL VLPVLLTVLL DRARGTFNLT SEALLFLLTV       420
     VGVACIGGVA SAVIASVTAS LLLNYWFIPP IGAFTLDNAD ALVALGVFAI VAATVAGVVD       480
     RSLRLSRRSA RATAEAETMS SLAGTIVRGG ATIPALLERT RETFGMESAD LVHHEQTPDE       540
     EGVTVVPAGP GAFLVLRGRT LPSSGRRVLA AFAAHVGSAV ERTRLAEAAA EIEPVKAADR       600
     MRTALLRAVG HDLRTPLAAG WAAVTSLRSR DVEFSDEDRD ELLATADESL AKLNRLVENL       660
     LDLSRLQAGV LTLDLRATTL EEVLPAALAD IPDVEVRDLE EIPAVMADPP LLERVIANLV       720
     GNAARHSPPG GQVALTASAH AGRVEVRVVD RGPGLPQTGR ERIFEPFQRL GDTDNTTGLG       780
     LGLALSKGLT EAMDGTLVPE DTPGGGLTMV LSLPFAERTV YSR                         823
//

If you have problems or comments...

PBIL Back to PBIL home page