(data stored in ACNUC7421 zone)

EMBL: CP002047.PE298

CP002047.PE298       Location/Qualifiers
FT   CDS             complement(335841..336281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03419"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR3"
FT                   /protein_id="ADI03419.1"
FT                   /translation="MGFAGLTLLLDWGSGGLTVGRADLWAVLGVLLFTVLRPPRVSAGD
FT                   GWLAVRGLVRERRVCTDALVAVRQDGSIATRLVLRDAYGGSVAFDPRILVANPLLWHRL
FT                   DAGARRSRERGTLRHGESTLRLLGERIDGETARDVLRASGLE"
     MGFAGLTLLL DWGSGGLTVG RADLWAVLGV LLFTVLRPPR VSAGDGWLAV RGLVRERRVC        60
     TDALVAVRQD GSIATRLVLR DAYGGSVAFD PRILVANPLL WHRLDAGARR SRERGTLRHG       120
     ESTLRLLGER IDGETARDVL RASGLE                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page