(data stored in ACNUC7421 zone)

EMBL: CP002047.PE299

CP002047.PE299       Location/Qualifiers
FT   CDS             complement(336542..337480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00299"
FT                   /product="band 7 family protein"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03420"
FT                   /db_xref="GOA:D7BWR4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR4"
FT                   /protein_id="ADI03420.1"
FT                   /translation="MEGAAAIAVVVVVALLLLILRSSMRIVNQVDRGVVFRFGKALPAY
FT                   RNPGITYLVPFADRMRKVNVQVVTLPIPTQEGITRDNVSVKVDAVVYFRVTDPVRAAIE
FT                   VQDYVFAVGQVAQSSLRSIIGKSDLDDLLSDRERLHEGLAVMIDSPAAGWGVHIDRVEI
FT                   KDVQLPESLKRSMSRQAEAERERRARVITADGEFQAARQLANASRIMSDTPEAMQLRLL
FT                   QTVVEVAAEKNSTLVMPFPVELLRYFDRAARRLGDGDDNAGDNGEGTRNDTKDGTKEPR
FT                   TARTATKDGTKDGNGDPSPGPGPENSSGPAQ"
     MEGAAAIAVV VVVALLLLIL RSSMRIVNQV DRGVVFRFGK ALPAYRNPGI TYLVPFADRM        60
     RKVNVQVVTL PIPTQEGITR DNVSVKVDAV VYFRVTDPVR AAIEVQDYVF AVGQVAQSSL       120
     RSIIGKSDLD DLLSDRERLH EGLAVMIDSP AAGWGVHIDR VEIKDVQLPE SLKRSMSRQA       180
     EAERERRARV ITADGEFQAA RQLANASRIM SDTPEAMQLR LLQTVVEVAA EKNSTLVMPF       240
     PVELLRYFDR AARRLGDGDD NAGDNGEGTR NDTKDGTKEP RTARTATKDG TKDGNGDPSP       300
     GPGPENSSGP AQ                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page