(data stored in ACNUC7421 zone)

EMBL: CP002047.PE3

CP002047.PE3         Location/Qualifiers
FT   CDS             complement(1672..2526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03124"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSU7"
FT                   /protein_id="ADI03124.1"
FT                   /translation="MKRERATMLLGEMLDRLDQGAWPLNLVEEVYLFGSYIRGALEVGD
FT                   IDVVVQHTTDERWKQESLDALFNGSDGYVTMRQALRGRRRGISFQFQERRTLEEEGFEL
FT                   LLLWRGGGGGEPVALARQRLDAITPDPAAGRAPRDHVLPPYETIADLLPRPVRIDLHRL
FT                   CADGVATVSAFPLPDAHPRSVVAAAHAEERWTSNSPLRRAATAALAHLESTGQVLDRVE
FT                   VHGQYLHQGTTDDDIDCFVDLGWRYWRRVKRYLGDGQAWFEVLPATTRKPLHALRITPA
FT                   SRA"
     MKRERATMLL GEMLDRLDQG AWPLNLVEEV YLFGSYIRGA LEVGDIDVVV QHTTDERWKQ        60
     ESLDALFNGS DGYVTMRQAL RGRRRGISFQ FQERRTLEEE GFELLLLWRG GGGGEPVALA       120
     RQRLDAITPD PAAGRAPRDH VLPPYETIAD LLPRPVRIDL HRLCADGVAT VSAFPLPDAH       180
     PRSVVAAAHA EERWTSNSPL RRAATAALAH LESTGQVLDR VEVHGQYLHQ GTTDDDIDCF       240
     VDLGWRYWRR VKRYLGDGQA WFEVLPATTR KPLHALRITP ASRA                        284
//

If you have problems or comments...

PBIL Back to PBIL home page