(data stored in ACNUC7421 zone)

EMBL: CP002047.PE302

CP002047.PE302       Location/Qualifiers
FT   CDS             340467..341627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00302"
FT                   /product="hypothetical protein"
FT                   /note="COG3211 Predicted phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03423"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR7"
FT                   /protein_id="ADI03423.1"
FT                   /translation="MERRIFLRGAVIGTSAAAFGGTLMRGAAYAAPAQNGPGPYGALGA
FT                   ADTNAIQLPTGFTSRVIARSGKVVSGTSYTWHNAPDGGACFADGTGWIYVSNSEVATGG
FT                   GVGAVKFDSSGTITGAHRILSNTRNNCAGGATPWQTWLSCEEVSRGYVYETDPWGVKAA
FT                   TRRDAMGQFKHEAAAADPVRKVIYLTEDETDGCFYRFTPTTWGDLSSGTLQVLVAGTAT
FT                   SGSFSWRDVPDPDGSPTATRDQVSSAKIFNGGEGCHYAGDTVWFTTKGDNRVWQLNLSN
FT                   STYELAYDDSLVNPGSAPLTGVDNVTGSSSGDLFVAEDGGNMEICIITPDDVVAPFLRI
FT                   NGQSGSEITGPAFSPDGTRLYFSSQRGTSGSSSGGITYEVTGPFRR"
     MERRIFLRGA VIGTSAAAFG GTLMRGAAYA APAQNGPGPY GALGAADTNA IQLPTGFTSR        60
     VIARSGKVVS GTSYTWHNAP DGGACFADGT GWIYVSNSEV ATGGGVGAVK FDSSGTITGA       120
     HRILSNTRNN CAGGATPWQT WLSCEEVSRG YVYETDPWGV KAATRRDAMG QFKHEAAAAD       180
     PVRKVIYLTE DETDGCFYRF TPTTWGDLSS GTLQVLVAGT ATSGSFSWRD VPDPDGSPTA       240
     TRDQVSSAKI FNGGEGCHYA GDTVWFTTKG DNRVWQLNLS NSTYELAYDD SLVNPGSAPL       300
     TGVDNVTGSS SGDLFVAEDG GNMEICIITP DDVVAPFLRI NGQSGSEITG PAFSPDGTRL       360
     YFSSQRGTSG SSSGGITYEV TGPFRR                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page