(data stored in ACNUC7421 zone)

EMBL: CP002047.PE303

CP002047.PE303       Location/Qualifiers
FT   CDS             complement(341701..343002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00303"
FT                   /product="membrane transport protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03424"
FT                   /db_xref="GOA:D7BWR8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWR8"
FT                   /protein_id="ADI03424.1"
FT                   /translation="MISLFSQVRSYERSVRLLMVNQFTINLGFYMLMPYLAAHLSGTLG
FT                   LAGWLVGLILGVRNFSQQGMFLVGGTLADRFGYKPLIIAGCVLRTAGFAALGFVDSLPA
FT                   LLAASAATGLAGALFNPAVRAYLAADAGERRVEAFALFNVFYQAGILLGPLVGMVLTGI
FT                   DFRVTCLTAAAVFAVLSVVQIRALPPRRADDARDGRDAARGSVLSQWRDVVANRPFLLF
FT                   SAAMIGSYVLSFQVYLALPLEVRRLGGQGEAGAAAVALLFAVSGLSTILGQTKVTAWCK
FT                   ARMAPGQALAWGLFTMGVAFLPLLLATAVPEPEGGAGRWLLAAVPPALSALLLALGTMI
FT                   AYPFEMDTIVRLSGDRLVATHYGLYNTICGVGITLGNLLTGAALDAARAAGMSALPWCA
FT                   LLMLGMVCAAALYGLHRTGRLAAVPAPRAQPAAA"
     MISLFSQVRS YERSVRLLMV NQFTINLGFY MLMPYLAAHL SGTLGLAGWL VGLILGVRNF        60
     SQQGMFLVGG TLADRFGYKP LIIAGCVLRT AGFAALGFVD SLPALLAASA ATGLAGALFN       120
     PAVRAYLAAD AGERRVEAFA LFNVFYQAGI LLGPLVGMVL TGIDFRVTCL TAAAVFAVLS       180
     VVQIRALPPR RADDARDGRD AARGSVLSQW RDVVANRPFL LFSAAMIGSY VLSFQVYLAL       240
     PLEVRRLGGQ GEAGAAAVAL LFAVSGLSTI LGQTKVTAWC KARMAPGQAL AWGLFTMGVA       300
     FLPLLLATAV PEPEGGAGRW LLAAVPPALS ALLLALGTMI AYPFEMDTIV RLSGDRLVAT       360
     HYGLYNTICG VGITLGNLLT GAALDAARAA GMSALPWCAL LMLGMVCAAA LYGLHRTGRL       420
     AAVPAPRAQP AAA                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page