(data stored in ACNUC7421 zone)

EMBL: CP002047.PE306

CP002047.PE306       Location/Qualifiers
FT   CDS             complement(344873..345334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03427"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS1"
FT                   /protein_id="ADI03427.1"
FT                   /translation="MVTARSLSAMPRSRPSGRALRLLWVAALLFGLVYAHGVSPESVAR
FT                   HLSSATVNLGVSVGEGPAVTAPVAAEKASDSGLTVRDHRDGGHASPHPAHECLIAQPQH
FT                   GSGVVAPCQAPLGRQPAPLVAPIEAVGPAPSSSAGCPFRNSAVCAVLQI"
     MVTARSLSAM PRSRPSGRAL RLLWVAALLF GLVYAHGVSP ESVARHLSSA TVNLGVSVGE        60
     GPAVTAPVAA EKASDSGLTV RDHRDGGHAS PHPAHECLIA QPQHGSGVVA PCQAPLGRQP       120
     APLVAPIEAV GPAPSSSAGC PFRNSAVCAV LQI                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page