(data stored in ACNUC7421 zone)

EMBL: CP002047.PE309

CP002047.PE309       Location/Qualifiers
FT   CDS             complement(347711..349147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00309"
FT                   /product="permease of the major facilitator superfamily
FT                   protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03430"
FT                   /db_xref="GOA:D7BWS4"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS4"
FT                   /protein_id="ADI03430.1"
FT                   /translation="MSHPHRAAHAEHAAPPDEAAEPRRWLMLALLCLAQFMLILDVTVV
FT                   NVALPDMAADLHLGRETLTWVVTAYTLCFGGLMLLGGRLADAVGAHRTVLAGLAVFTAA
FT                   SLATGLATGAPTLLGGRIFQGVGAALLSPSALSMVTTSFQGEERNKALGAWAAVGGTGS
FT                   AVGVLLGGVLTDGPGWEWVFYLNVPVGVLALATLPALLPRRSPQPVRLDLPGAVLVTAG
FT                   TASLIYGLVKAGDAGWGDATAVLPLLGALVLYAAFVGVERVSRAPLMDPRMFTRRPVVA
FT                   GAFLMLVATALLIAFFFLGSVYLQRVRGFSPLRTGLVFLPVAVATGVGAHLGSRLVGRI
FT                   GSRVTATAGMAVAAAGTVPLTWVAADGSVYAGLLPGLAIASLGIGAVFVTATTTALAMV
FT                   THEEAGLASGVVNTFHEVGGSVGVAVMSTVAAAGIEHGAIGGFTDAFTLSATVAAASLP
FT                   MTLLLVPRGKPQLTGRPHMH"
     MSHPHRAAHA EHAAPPDEAA EPRRWLMLAL LCLAQFMLIL DVTVVNVALP DMAADLHLGR        60
     ETLTWVVTAY TLCFGGLMLL GGRLADAVGA HRTVLAGLAV FTAASLATGL ATGAPTLLGG       120
     RIFQGVGAAL LSPSALSMVT TSFQGEERNK ALGAWAAVGG TGSAVGVLLG GVLTDGPGWE       180
     WVFYLNVPVG VLALATLPAL LPRRSPQPVR LDLPGAVLVT AGTASLIYGL VKAGDAGWGD       240
     ATAVLPLLGA LVLYAAFVGV ERVSRAPLMD PRMFTRRPVV AGAFLMLVAT ALLIAFFFLG       300
     SVYLQRVRGF SPLRTGLVFL PVAVATGVGA HLGSRLVGRI GSRVTATAGM AVAAAGTVPL       360
     TWVAADGSVY AGLLPGLAIA SLGIGAVFVT ATTTALAMVT HEEAGLASGV VNTFHEVGGS       420
     VGVAVMSTVA AAGIEHGAIG GFTDAFTLSA TVAAASLPMT LLLVPRGKPQ LTGRPHMH         478
//

If you have problems or comments...

PBIL Back to PBIL home page