(data stored in ACNUC7421 zone)

EMBL: CP002047.PE311

CP002047.PE311       Location/Qualifiers
FT   CDS             complement(350056..353535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00311"
FT                   /product="putative NRPS"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03432"
FT                   /db_xref="GOA:D7BWS6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS6"
FT                   /protein_id="ADI03432.1"
FT                   /translation="MHVTYRPLSVADTDGSASPIGVRIPDLRIYVLDGRGRPVPLGAVG
FT                   ELHVGGAGVARGYLNRPELTEQRFLPDPYGDRTGARMYRTGDLVRQLPDGSLEYVGRND
FT                   DQVKIRGFRIELGEIEAALAQHEAVAHGVVVPQGSADGRTLVAYLRPTRQWLDAAAQEQ
FT                   NTLLLDQWQTVFEDEYAGSHDEHDKHPADDLNLAGWESSYTGRPIPEPDMREWIDGTVH
FT                   RIHQLRPQRLLEIGCGTGLLLFRYAEACRAVHAVDLSASALADVRQGVERRGWSHITLA
FT                   QGDALSVADLPEAGFDTVVINSVAQYFPNRHYLEQALTRILPLVADGGRILIGDVRNLD
FT                   LLTPHLIAVERGHATGRTTAADLTAQVQRRRRQESELLFSPTYFTRLPARFPDLGGVDV
FT                   MVKRGVGDNEMLAYRYDVILTKSAPTATPTAAVTEPDLPWLEANTPDELRNLLEDPATP
FT                   DRFGVTGLTNPQIADDIRVSDALTRWAPTHDIAPLPHGTRLSPQAATAVRELETVLRHA
FT                   EHLGYQVAPTWSQDRPDGLDLILGKHDLPRVQARAPYRATHLANTVRIGDLGPAMARLL
FT                   KEHLTTRLPEYMVPGVFMLLEELPVTLNGKVDKRALPAPDEDAVARQEYVAPHTDTQTT
FT                   LCRILEDVLGLGRVGLEDTFFALGGHSLLAVRLNLRVRQELGRELPLQLILTGATVAEL
FT                   AAALEDEQTAADGVPLIPAVPVRDGEEAPLALQQGDLWFLNHPRHLPASYDNAQLAYRI
FT                   DGPLDRDAFVRAARALVVRHPVLRTGYVRRDGTVTQRMNDAEGFEVTVTEPIADDNALI
FT                   QWLREERTRPFAPEDPYAIRVHLVPVADEQHIFVLTRPWGVFDGWSLTIVLTELVALYR
FT                   QLSGGAEPELPGLPLAYADFARWQRQTVGTAELDRQRAYWRRQLDGLPACLSLRTDRPR
FT                   GAVKSYRGASVDFGVPLDVLTRLRQLSQEHGGSLYMTLLSAFAVLLGGHTDDREVAIGS
FT                   PVSHRPRAELEGLVGYFVNTLLIRLDIAPDRPFTELLAQARQVTAEAHDHKDLPFTELV
FT                   RDLVPEPDPAHSPLLQTMVNLVPNPAPTAGGDDAGDLRISPVDTGSRTAKHDLNLTALE
FT                   TESGLSGYLEYSTDLFADETAAHLVRSYERLLRKIAADPGADLARLRERAGD"
     MHVTYRPLSV ADTDGSASPI GVRIPDLRIY VLDGRGRPVP LGAVGELHVG GAGVARGYLN        60
     RPELTEQRFL PDPYGDRTGA RMYRTGDLVR QLPDGSLEYV GRNDDQVKIR GFRIELGEIE       120
     AALAQHEAVA HGVVVPQGSA DGRTLVAYLR PTRQWLDAAA QEQNTLLLDQ WQTVFEDEYA       180
     GSHDEHDKHP ADDLNLAGWE SSYTGRPIPE PDMREWIDGT VHRIHQLRPQ RLLEIGCGTG       240
     LLLFRYAEAC RAVHAVDLSA SALADVRQGV ERRGWSHITL AQGDALSVAD LPEAGFDTVV       300
     INSVAQYFPN RHYLEQALTR ILPLVADGGR ILIGDVRNLD LLTPHLIAVE RGHATGRTTA       360
     ADLTAQVQRR RRQESELLFS PTYFTRLPAR FPDLGGVDVM VKRGVGDNEM LAYRYDVILT       420
     KSAPTATPTA AVTEPDLPWL EANTPDELRN LLEDPATPDR FGVTGLTNPQ IADDIRVSDA       480
     LTRWAPTHDI APLPHGTRLS PQAATAVREL ETVLRHAEHL GYQVAPTWSQ DRPDGLDLIL       540
     GKHDLPRVQA RAPYRATHLA NTVRIGDLGP AMARLLKEHL TTRLPEYMVP GVFMLLEELP       600
     VTLNGKVDKR ALPAPDEDAV ARQEYVAPHT DTQTTLCRIL EDVLGLGRVG LEDTFFALGG       660
     HSLLAVRLNL RVRQELGREL PLQLILTGAT VAELAAALED EQTAADGVPL IPAVPVRDGE       720
     EAPLALQQGD LWFLNHPRHL PASYDNAQLA YRIDGPLDRD AFVRAARALV VRHPVLRTGY       780
     VRRDGTVTQR MNDAEGFEVT VTEPIADDNA LIQWLREERT RPFAPEDPYA IRVHLVPVAD       840
     EQHIFVLTRP WGVFDGWSLT IVLTELVALY RQLSGGAEPE LPGLPLAYAD FARWQRQTVG       900
     TAELDRQRAY WRRQLDGLPA CLSLRTDRPR GAVKSYRGAS VDFGVPLDVL TRLRQLSQEH       960
     GGSLYMTLLS AFAVLLGGHT DDREVAIGSP VSHRPRAELE GLVGYFVNTL LIRLDIAPDR      1020
     PFTELLAQAR QVTAEAHDHK DLPFTELVRD LVPEPDPAHS PLLQTMVNLV PNPAPTAGGD      1080
     DAGDLRISPV DTGSRTAKHD LNLTALETES GLSGYLEYST DLFADETAAH LVRSYERLLR      1140
     KIAADPGADL ARLRERAGD                                                   1159
//

If you have problems or comments...

PBIL Back to PBIL home page