(data stored in ACNUC7421 zone)

EMBL: CP002047.PE312

CP002047.PE312       Location/Qualifiers
FT   CDS             complement(353749..356748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00312"
FT                   /product="putative NRPS"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03433"
FT                   /db_xref="GOA:D7BWS7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS7"
FT                   /protein_id="ADI03433.1"
FT                   /translation="MVFGGEALDVAALDPWLRRPLNGDTQLVNMYGITETTVHVTYRPL
FT                   TPADIHGSASPIGVRIPDLRVYVLDGQGEPVPVGAVGELYVGGAGVARGYLNRPELTAQ
FT                   RFLPDRFAGQPDARMYRTGDLVRQRPDGSLEYVGRNDGQVKIRGFRIELGEIEAAVGRH
FT                   EAVRSCVVVAREDQPGGKQLVAYVVPAVKHPEQDLRAELGRHAERLLPEYMVPSAFVVL
FT                   ETLPLTTNGKLDRKALPAPGIDAYARREYVAPSTATERALAAVWAELLGFDEERVGAGD
FT                   NFFELGGHSLLITVLVARIKELGHEVSVRNVFASPTLARLAAEIDRGVAAEAYEPPPNL
FT                   IEEGCERITPDQLPLVELAQEQIDAIVATVPAGAANVSDIYPLAPAQEGILFHHLLDPD
FT                   NDPYLVSILLAADDKSACDRFTRALQALIDRHDVLRTAVRTTGLPEPVQIVQRTARLTV
FT                   ERTLLDPDHDVERQARALLDRPRALAVDQAPLLRLLIAEDPHTDRRYLLLSAHHLIEDA
FT                   TTLRLFLQELAVHMAGRTEPPPPAPYRDFVAHTLHRMASTDAETHFRAALGDVHEPTTP
FT                   FGLTNVRGDGHRYPQLRRALPAELTRQIRAQAQRLHLSPACLFHAAWACVVAAATGRDD
FT                   VVLGTVMSGRLQGVPGVERMLGNFINTLPLRVRLAGRTVRELIADVDSGLQELIAREQT
FT                   PLSLAQSSSGLGGDALFSSVVNVRHFEPGHGGPAATGLEEQGIHWLGETDAINYPLSLS
FT                   LDDFGSELSLHVRVDDAVSCEAVVDYVETALTGIVAALATHDGTRTEALAVDVLPAAER
FT                   HRVLVEWNERPGGVVSRERSVHGWFEEVVAGSRDVVAVEYEGCSLTYGELNARANRLAR
FT                   HLRGLGVGRDVLVALCLPRSERLLVCVLAVLKAGGAYVPIDPAVPVERLRYILDDSAPR
FT                   VLLVDGSVPDGLDTLDIPVVDIHADAPAWESLPDGDPDHTGGAPTDLAYVIYTSGSTGA
FT                   PKGVLVETGM"
     MVFGGEALDV AALDPWLRRP LNGDTQLVNM YGITETTVHV TYRPLTPADI HGSASPIGVR        60
     IPDLRVYVLD GQGEPVPVGA VGELYVGGAG VARGYLNRPE LTAQRFLPDR FAGQPDARMY       120
     RTGDLVRQRP DGSLEYVGRN DGQVKIRGFR IELGEIEAAV GRHEAVRSCV VVAREDQPGG       180
     KQLVAYVVPA VKHPEQDLRA ELGRHAERLL PEYMVPSAFV VLETLPLTTN GKLDRKALPA       240
     PGIDAYARRE YVAPSTATER ALAAVWAELL GFDEERVGAG DNFFELGGHS LLITVLVARI       300
     KELGHEVSVR NVFASPTLAR LAAEIDRGVA AEAYEPPPNL IEEGCERITP DQLPLVELAQ       360
     EQIDAIVATV PAGAANVSDI YPLAPAQEGI LFHHLLDPDN DPYLVSILLA ADDKSACDRF       420
     TRALQALIDR HDVLRTAVRT TGLPEPVQIV QRTARLTVER TLLDPDHDVE RQARALLDRP       480
     RALAVDQAPL LRLLIAEDPH TDRRYLLLSA HHLIEDATTL RLFLQELAVH MAGRTEPPPP       540
     APYRDFVAHT LHRMASTDAE THFRAALGDV HEPTTPFGLT NVRGDGHRYP QLRRALPAEL       600
     TRQIRAQAQR LHLSPACLFH AAWACVVAAA TGRDDVVLGT VMSGRLQGVP GVERMLGNFI       660
     NTLPLRVRLA GRTVRELIAD VDSGLQELIA REQTPLSLAQ SSSGLGGDAL FSSVVNVRHF       720
     EPGHGGPAAT GLEEQGIHWL GETDAINYPL SLSLDDFGSE LSLHVRVDDA VSCEAVVDYV       780
     ETALTGIVAA LATHDGTRTE ALAVDVLPAA ERHRVLVEWN ERPGGVVSRE RSVHGWFEEV       840
     VAGSRDVVAV EYEGCSLTYG ELNARANRLA RHLRGLGVGR DVLVALCLPR SERLLVCVLA       900
     VLKAGGAYVP IDPAVPVERL RYILDDSAPR VLLVDGSVPD GLDTLDIPVV DIHADAPAWE       960
     SLPDGDPDHT GGAPTDLAYV IYTSGSTGAP KGVLVETGM                              999
//

If you have problems or comments...

PBIL Back to PBIL home page