(data stored in ACNUC7421 zone)

EMBL: CP002047.PE314

CP002047.PE314       Location/Qualifiers
FT   CDS             complement(367641..368693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00314"
FT                   /product="putative 3-oxoacyl-ACP synthase III"
FT                   /note="COG0332 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03435"
FT                   /db_xref="GOA:D7BWS9"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWS9"
FT                   /protein_id="ADI03435.1"
FT                   /translation="MRWNDVYIDASGVRLGRLEDVWQAVAEGRYDADECKTDDLVSVSV
FT                   VDDLSHADLAVEAGRRALSRSTAAHDDFMLVAHATSFGFQGLDHWAPAAYIQSRTVGGR
FT                   APAINLQQASNGGLGTLDLAAAYVAAGGPSSAALITTSDKYQLPMYDRYRSDKRAPRGD
FT                   GATAVVLKRGSGVAKLLSTAVICDTTHEGAYRGASPWAAAAGEHGWPVSLRQRFKEYLS
FT                   SSGVEVADTAKAGAAGQQLVMELAMGEAGVGLKDVARFVYPHAGRAVIDWDEVKKIAGI
FT                   DVEQTNWEFGRRLGHLGAGDQFAGVNHLLETKAVKPGDIVVLSSVGHGYTFGCAVLEIV
FT                   AEPEWPEESG"
     MRWNDVYIDA SGVRLGRLED VWQAVAEGRY DADECKTDDL VSVSVVDDLS HADLAVEAGR        60
     RALSRSTAAH DDFMLVAHAT SFGFQGLDHW APAAYIQSRT VGGRAPAINL QQASNGGLGT       120
     LDLAAAYVAA GGPSSAALIT TSDKYQLPMY DRYRSDKRAP RGDGATAVVL KRGSGVAKLL       180
     STAVICDTTH EGAYRGASPW AAAAGEHGWP VSLRQRFKEY LSSSGVEVAD TAKAGAAGQQ       240
     LVMELAMGEA GVGLKDVARF VYPHAGRAVI DWDEVKKIAG IDVEQTNWEF GRRLGHLGAG       300
     DQFAGVNHLL ETKAVKPGDI VVLSSVGHGY TFGCAVLEIV AEPEWPEESG                  350
//

If you have problems or comments...

PBIL Back to PBIL home page