(data stored in ACNUC7421 zone)

EMBL: CP002047.PE316

CP002047.PE316       Location/Qualifiers
FT   CDS             369886..370617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00316"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03437"
FT                   /db_xref="GOA:D7BWT1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWT1"
FT                   /protein_id="ADI03437.1"
FT                   /translation="MRFTSETSSDGVSEQLFTLGEIPGALWTPEGVVGTRPLILLGHGG
FT                   GQHKKAPDILTLAHRLVAECGFAAVAVDVPSHGDRPQHEEYSRIAADNQARVEAGEELA
FT                   PLIARFQALVARQTVPEWRAVLDAVQQLEHVGTGPVGYWGVSLGCGLGVPFVAAEPRVR
FT                   AAVLGLGGALASAEDAARITVPVEFLVQWDDERVPRAQSLALFDALASSEKTLHANPGK
FT                   HGEVPAFERDSTLRFFSRHLI"
     MRFTSETSSD GVSEQLFTLG EIPGALWTPE GVVGTRPLIL LGHGGGQHKK APDILTLAHR        60
     LVAECGFAAV AVDVPSHGDR PQHEEYSRIA ADNQARVEAG EELAPLIARF QALVARQTVP       120
     EWRAVLDAVQ QLEHVGTGPV GYWGVSLGCG LGVPFVAAEP RVRAAVLGLG GALASAEDAA       180
     RITVPVEFLV QWDDERVPRA QSLALFDALA SSEKTLHANP GKHGEVPAFE RDSTLRFFSR       240
     HLI                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page