(data stored in ACNUC7421 zone)

EMBL: CP002047.PE317

CP002047.PE317       Location/Qualifiers
FT   CDS             370768..372984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00317"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03438"
FT                   /db_xref="GOA:D7BWT2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWT2"
FT                   /protein_id="ADI03438.1"
FT                   /translation="MAGMKLYSLESNDPPQLGPYRLLRRIATGGMGRIYLARQAAPGTA
FT                   AGPAGPTGTVVDHGLVAVKTLLAEGFVSKPDRERFAREVELAGRVDSAYTATVLDANAK
FT                   AERPWLAIEFIPAPSLGELVVNAGTLPADAVRWVAAAAARALVELHGRGVVHRDIKPLN
FT                   ILLPHDGPRLIDFGISHAHDHTSSTTTIGTFAFTSPEQACGKKSTAASDMYSLGATLFF
FT                   LSVGRAPYEQTDHSFGILALVQRGELDTDGLPPELEPLILPLLRVDPESRPTPSDVLRD
FT                   VLADIDQVSAEPRLPQAWTALIEEYAEQGRQLRDGAVDFAAAEAPTQVRPEGPPERADE
FT                   AISEMREQLEALRKQRDALVQAQAEEQAEAEARELARQEEEERRRREQARKEEAERRER
FT                   ERKEQERKERERKEKERKERERKERERKESQRKERERIAREKTETAAQNKSTSTTWTPK
FT                   APPKPAAAKQPAKSSGSSESWGGLLLVALIIGALVWHPWDKKDDDTPKSSPSSGVTLSS
FT                   SSGTTSGTDGGSDDDSDSGTDGYSSSSSSSSSSGGLDDTETEPEPETTSPEPEPDPTEE
FT                   AFKAVSYGDCLDVVDTGYGGTTKYDWSEEEPNTTSCGYGTRVKVTGTSGDCPSGVGKAT
FT                   WSYYSTSSGERSELCLTGQYRQGDCLLAKHEGNTISSIAMLSSPNCTDRKVPVPYNEIL
FT                   VVTNVYRATGAGAEVCRQGQYDSNTYWSTEVDDGATQLCLKAYD"
     MAGMKLYSLE SNDPPQLGPY RLLRRIATGG MGRIYLARQA APGTAAGPAG PTGTVVDHGL        60
     VAVKTLLAEG FVSKPDRERF AREVELAGRV DSAYTATVLD ANAKAERPWL AIEFIPAPSL       120
     GELVVNAGTL PADAVRWVAA AAARALVELH GRGVVHRDIK PLNILLPHDG PRLIDFGISH       180
     AHDHTSSTTT IGTFAFTSPE QACGKKSTAA SDMYSLGATL FFLSVGRAPY EQTDHSFGIL       240
     ALVQRGELDT DGLPPELEPL ILPLLRVDPE SRPTPSDVLR DVLADIDQVS AEPRLPQAWT       300
     ALIEEYAEQG RQLRDGAVDF AAAEAPTQVR PEGPPERADE AISEMREQLE ALRKQRDALV       360
     QAQAEEQAEA EARELARQEE EERRRREQAR KEEAERRERE RKEQERKERE RKEKERKERE       420
     RKERERKESQ RKERERIARE KTETAAQNKS TSTTWTPKAP PKPAAAKQPA KSSGSSESWG       480
     GLLLVALIIG ALVWHPWDKK DDDTPKSSPS SGVTLSSSSG TTSGTDGGSD DDSDSGTDGY       540
     SSSSSSSSSS GGLDDTETEP EPETTSPEPE PDPTEEAFKA VSYGDCLDVV DTGYGGTTKY       600
     DWSEEEPNTT SCGYGTRVKV TGTSGDCPSG VGKATWSYYS TSSGERSELC LTGQYRQGDC       660
     LLAKHEGNTI SSIAMLSSPN CTDRKVPVPY NEILVVTNVY RATGAGAEVC RQGQYDSNTY       720
     WSTEVDDGAT QLCLKAYD                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page