(data stored in ACNUC7421 zone)

EMBL: CP002047.PE318

CP002047.PE318       Location/Qualifiers
FT   CDS             complement(373001..374830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00318"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="COG3573 Predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03439"
FT                   /db_xref="GOA:D7BYB1"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014614"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB1"
FT                   /protein_id="ADI03439.1"
FT                   /translation="MDNHRESSEARHGHGSEFPAGVSRRHALTVAGGVLAGAALAQMAV
FT                   PAFAAPAASADADAIVVGHGLAGLVATAELAAAGRKVLLLDQEPESNLGGQAFWSFGGL
FT                   FFVDSEEQRLMGIKDSRELAWQDWLGTAGFDRGIDDPAGQDHWAYKWAEAYVDFAAGEK
FT                   RSWLYGLGVRWFPIVGWAERGGGLADGHGNSVPRFHVTWGTGPAVVEPFEKKVRDAVAA
FT                   GKVTFKFRHRVDGIVTTGGAVTGVRGAILEPSDAARGKPTSRTVVGDFELRAPVVIVTS
FT                   GGIGANHDLVRQNWPARLGTPPKFMVTGVPAHVDGRMLAITEKAGGRIVNPDRMWHYTE
FT                   GLRNYDPIWPGHGIRILPGPSSMWFDATGKRFNTPDIPGYDTLHTLKSITDSGYDYSWF
FT                   VTTQKIIAKEFALSGSEQNPDLTEKNIWKLLSRIWQTPEPIEKFKEKGADFVVATTLPE
FT                   LVAGMNKLTGDNLIDLADLKRQIDARDREIDNPYTKDVQVMGIRNALSYPGDSLSRTAS
FT                   AHKILDSGAGPLIAVRLNILTRKTLGGLQTDLSGRVLDSTGNPIPGLYAAGEVAGFGGG
FT                   GVHGYRSLEGTFLGGCLFSGRQTGRAAAAATAS"
     MDNHRESSEA RHGHGSEFPA GVSRRHALTV AGGVLAGAAL AQMAVPAFAA PAASADADAI        60
     VVGHGLAGLV ATAELAAAGR KVLLLDQEPE SNLGGQAFWS FGGLFFVDSE EQRLMGIKDS       120
     RELAWQDWLG TAGFDRGIDD PAGQDHWAYK WAEAYVDFAA GEKRSWLYGL GVRWFPIVGW       180
     AERGGGLADG HGNSVPRFHV TWGTGPAVVE PFEKKVRDAV AAGKVTFKFR HRVDGIVTTG       240
     GAVTGVRGAI LEPSDAARGK PTSRTVVGDF ELRAPVVIVT SGGIGANHDL VRQNWPARLG       300
     TPPKFMVTGV PAHVDGRMLA ITEKAGGRIV NPDRMWHYTE GLRNYDPIWP GHGIRILPGP       360
     SSMWFDATGK RFNTPDIPGY DTLHTLKSIT DSGYDYSWFV TTQKIIAKEF ALSGSEQNPD       420
     LTEKNIWKLL SRIWQTPEPI EKFKEKGADF VVATTLPELV AGMNKLTGDN LIDLADLKRQ       480
     IDARDREIDN PYTKDVQVMG IRNALSYPGD SLSRTASAHK ILDSGAGPLI AVRLNILTRK       540
     TLGGLQTDLS GRVLDSTGNP IPGLYAAGEV AGFGGGGVHG YRSLEGTFLG GCLFSGRQTG       600
     RAAAAATAS                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page