(data stored in ACNUC7421 zone)

EMBL: CP002047.PE320

CP002047.PE320       Location/Qualifiers
FT   CDS             381414..383888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00320"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="COG0764 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03441"
FT                   /db_xref="GOA:D7BYB3"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB3"
FT                   /protein_id="ADI03441.1"
FT                   /translation="MADTDGAAAVAPNGGWGFEAAEELGFEGEPFLLPVPSAAPTPPAA
FT                   RGTGDLNHLARDIAERVGRAHAAVLEAHEAVQRHLLARYAPGARPPAPALHPVDRPAPV
FT                   ELVRTVPADAAYSVAGQADPAWILDAAAAALPLLGERGLAPAGAVYRPGRTNLSWHRGL
FT                   PEAGAELRVRAGAEAVHRDEHGTRFTFDWQVHVEGDLLVEATGTAGFLSPEHTTEPLPA
FT                   GEDSWPERQVPRYPRQFRPLANARRSRLTWQELRALASGFLAEVLGPDFEGEGTGPRLP
FT                   GPAPRLIGAITELSREGGRYGQGKVTADLTFHGFHGGGPARGADATPLLAEAVVGVLQV
FT                   YALSCGLHLCLPDPRFQPWAGGPTAIEVIDPTALGATLRCEVDVAEVGLVPRPHAIADA
FT                   VVLADDRPVARLHGIGVALQEPPGSDLGALTIWEARDSPAAHESLRQRGARQRMLLAHS
FT                   AEGDLSALTGEPEAISVSPVTVRPRLPRGDLLMVDQALDYDADPLEFRPGATLTSEYAV
FT                   HPDPWFCREYGSGAVPNLLYMESSLQAAAQLSAVQGILNQHLDSAFVCRNLEGRATLLR
FT                   HADPRGLALRHRITLADHSKLPGAILHRYTYELGLPDGPVYSGESVHGFLTKEVLDNQQ
FT                   GLDGGRYVPPWLNRLPTRPPGLRRLDLSRDTRLGSGRFALLHEADLVPDGGEHDTGYLL
FT                   WERTVPKDDWFMAHHFRFDPVMPGSVGVEALFQSVAAYALHTGLADALPDPAARPAAQV
FT                   ELAWKYRGQITPGHRRMRGEVHIRRVEPCGDGLLLVADGSVWRDDLRIYQVDNIGVEIL
FT                   PTGGAAEGQVPR"
     MADTDGAAAV APNGGWGFEA AEELGFEGEP FLLPVPSAAP TPPAARGTGD LNHLARDIAE        60
     RVGRAHAAVL EAHEAVQRHL LARYAPGARP PAPALHPVDR PAPVELVRTV PADAAYSVAG       120
     QADPAWILDA AAAALPLLGE RGLAPAGAVY RPGRTNLSWH RGLPEAGAEL RVRAGAEAVH       180
     RDEHGTRFTF DWQVHVEGDL LVEATGTAGF LSPEHTTEPL PAGEDSWPER QVPRYPRQFR       240
     PLANARRSRL TWQELRALAS GFLAEVLGPD FEGEGTGPRL PGPAPRLIGA ITELSREGGR       300
     YGQGKVTADL TFHGFHGGGP ARGADATPLL AEAVVGVLQV YALSCGLHLC LPDPRFQPWA       360
     GGPTAIEVID PTALGATLRC EVDVAEVGLV PRPHAIADAV VLADDRPVAR LHGIGVALQE       420
     PPGSDLGALT IWEARDSPAA HESLRQRGAR QRMLLAHSAE GDLSALTGEP EAISVSPVTV       480
     RPRLPRGDLL MVDQALDYDA DPLEFRPGAT LTSEYAVHPD PWFCREYGSG AVPNLLYMES       540
     SLQAAAQLSA VQGILNQHLD SAFVCRNLEG RATLLRHADP RGLALRHRIT LADHSKLPGA       600
     ILHRYTYELG LPDGPVYSGE SVHGFLTKEV LDNQQGLDGG RYVPPWLNRL PTRPPGLRRL       660
     DLSRDTRLGS GRFALLHEAD LVPDGGEHDT GYLLWERTVP KDDWFMAHHF RFDPVMPGSV       720
     GVEALFQSVA AYALHTGLAD ALPDPAARPA AQVELAWKYR GQITPGHRRM RGEVHIRRVE       780
     PCGDGLLLVA DGSVWRDDLR IYQVDNIGVE ILPTGGAAEG QVPR                        824
//

If you have problems or comments...

PBIL Back to PBIL home page