(data stored in ACNUC7421 zone)

EMBL: CP002047.PE323

CP002047.PE323       Location/Qualifiers
FT   CDS             386496..386861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00323"
FT                   /product="hypothetical protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03444"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB6"
FT                   /protein_id="ADI03444.1"
FT                   /translation="MAGGVQRRQAEAGARYDVFHTDCAARDVVDHVTSRWGVWVLISLR
FT                   SNDLRFYELRESIQGISEKMLAQTLRALVQDGLVWREVEPTTPPQVTYGLTEFGRDVGE
FT                   PLTELFDRITRRLPPRP"
     MAGGVQRRQA EAGARYDVFH TDCAARDVVD HVTSRWGVWV LISLRSNDLR FYELRESIQG        60
     ISEKMLAQTL RALVQDGLVW REVEPTTPPQ VTYGLTEFGR DVGEPLTELF DRITRRLPPR       120
     P                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page