(data stored in ACNUC7421 zone)

EMBL: CP002047.PE324

CP002047.PE324       Location/Qualifiers
FT   CDS             387147..387581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00324"
FT                   /product="hypothetical protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03445"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB7"
FT                   /protein_id="ADI03445.1"
FT                   /translation="MDSVGETGKQPRSEAWKTAAQMLQDAKPPFLPEGASGMTISVEWL
FT                   PGDPGTPPHRHSGPAFGYVIEGAVRFELEGEPERVIKAGETFWEPGGDVIHYQDGNALT
FT                   DSKTRFIVTMLCAPGQPMLTLVDEEELAQRAHLRAPRPVD"
     MDSVGETGKQ PRSEAWKTAA QMLQDAKPPF LPEGASGMTI SVEWLPGDPG TPPHRHSGPA        60
     FGYVIEGAVR FELEGEPERV IKAGETFWEP GGDVIHYQDG NALTDSKTRF IVTMLCAPGQ       120
     PMLTLVDEEE LAQRAHLRAP RPVD                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page