(data stored in ACNUC7421 zone)

EMBL: CP002047.PE326

CP002047.PE326       Location/Qualifiers
FT   CDS             388713..389039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00326"
FT                   /product="hydroperoxide resistance protein"
FT                   /note="COG1764 Predicted redox protein, regulator of
FT                   disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03447"
FT                   /db_xref="GOA:D7BYB9"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYB9"
FT                   /protein_id="ADI03447.1"
FT                   /translation="MPAELGGDGQGTNPEQLFAAGFAACFHGALSLVARQAALDPSTIS
FT                   VDATVAFGRDPEDGGYLLHVDLVVSWPGTDPEIAAPLLEKADSLCPYARMAWQGTPTTI
FT                   TLAS"
     MPAELGGDGQ GTNPEQLFAA GFAACFHGAL SLVARQAALD PSTISVDATV AFGRDPEDGG        60
     YLLHVDLVVS WPGTDPEIAA PLLEKADSLC PYARMAWQGT PTTITLAS                    108
//

If you have problems or comments...

PBIL Back to PBIL home page