(data stored in ACNUC7421 zone)

EMBL: CP002047.PE329

CP002047.PE329       Location/Qualifiers
FT   CDS             391044..392768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00329"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /note="COG1053 Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03450"
FT                   /db_xref="GOA:D7BYC2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC2"
FT                   /protein_id="ADI03450.1"
FT                   /translation="MIERRLSTTVLVIGTGGAGLRAAIELAESGVDVLAVGKRPKEDAH
FT                   TALAAGGINAALATMDPEDSWQQHAADTLKESYLLADPRTTQIVTQGAARGIDDLERYG
FT                   MAFAREGDGRISQRFFGAHKFRRTAFAGDYTGLEIQRTLIRRADQLDIPVLDGVYITRL
FT                   LVHDGAVFGAYGFDLTHGTRYLIHADAVILAAGGHTRIWRRTSSRRDENTGDSFRLAVE
FT                   AGARLRDPELVQFHPSGIIEPENAAGTLVSEAARGEGGVLRNALGERFMTRYDPERMEL
FT                   STRDRVALASYTEIKEGRGTPNGAVWLDVSHLPRQTIMTRLPRVYQTLLDLQMLDITRE
FT                   PIEIAPTAHYSMGGVWVRPEDHSTDVRGLYAIGEASSGLHGANRLGGNSLIELLVFGRI
FT                   TGQAAAAYSEALTAQPRSASAVAQARAEIDDLLAADGPENVRALQRAIRNTMTEHAGVV
FT                   RDGEGLRAGLAELTAIEKRMEDVGVHPDIAGYQDLAHAFDLKSAALAARATLEAALERR
FT                   ETRGCHNRSDYPDLDPALQVNLVWSPTTGVTHESIPPIPDEISALMEDVSTEGKLVE"
     MIERRLSTTV LVIGTGGAGL RAAIELAESG VDVLAVGKRP KEDAHTALAA GGINAALATM        60
     DPEDSWQQHA ADTLKESYLL ADPRTTQIVT QGAARGIDDL ERYGMAFARE GDGRISQRFF       120
     GAHKFRRTAF AGDYTGLEIQ RTLIRRADQL DIPVLDGVYI TRLLVHDGAV FGAYGFDLTH       180
     GTRYLIHADA VILAAGGHTR IWRRTSSRRD ENTGDSFRLA VEAGARLRDP ELVQFHPSGI       240
     IEPENAAGTL VSEAARGEGG VLRNALGERF MTRYDPERME LSTRDRVALA SYTEIKEGRG       300
     TPNGAVWLDV SHLPRQTIMT RLPRVYQTLL DLQMLDITRE PIEIAPTAHY SMGGVWVRPE       360
     DHSTDVRGLY AIGEASSGLH GANRLGGNSL IELLVFGRIT GQAAAAYSEA LTAQPRSASA       420
     VAQARAEIDD LLAADGPENV RALQRAIRNT MTEHAGVVRD GEGLRAGLAE LTAIEKRMED       480
     VGVHPDIAGY QDLAHAFDLK SAALAARATL EAALERRETR GCHNRSDYPD LDPALQVNLV       540
     WSPTTGVTHE SIPPIPDEIS ALMEDVSTEG KLVE                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page