(data stored in ACNUC7421 zone)

EMBL: CP002047.PE330

CP002047.PE330       Location/Qualifiers
FT   CDS             392942..393676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00330"
FT                   /product="hypothetical protein"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03451"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC3"
FT                   /protein_id="ADI03451.1"
FT                   /translation="MIGGTGLIGSKLVGKLTEHGHEAVAAAPNTGVNTLTGEGLAEVLE
FT                   GASVVVDVSNSPSFEDEAVMDFFRTSTTNLLKAEAEAGVTHHVALSVVGTERLQESGYF
FT                   RAKQAQEELIKDSGIPYSIVHATQFFEFAKGLADGVTDGDTVRLPAGKIQPIVSDDVAA
FT                   AVGRTAVGPPVNGVVEVAGPEAFELEDFIRMGLAAKNDPRKIVTDPKATYWGAELQETT
FT                   LLPGPDAHIAETKFADWLAQQQ"
     MIGGTGLIGS KLVGKLTEHG HEAVAAAPNT GVNTLTGEGL AEVLEGASVV VDVSNSPSFE        60
     DEAVMDFFRT STTNLLKAEA EAGVTHHVAL SVVGTERLQE SGYFRAKQAQ EELIKDSGIP       120
     YSIVHATQFF EFAKGLADGV TDGDTVRLPA GKIQPIVSDD VAAAVGRTAV GPPVNGVVEV       180
     AGPEAFELED FIRMGLAAKN DPRKIVTDPK ATYWGAELQE TTLLPGPDAH IAETKFADWL       240
     AQQQ                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page