(data stored in ACNUC7421 zone)

EMBL: CP002047.PE334

CP002047.PE334       Location/Qualifiers
FT   CDS             complement(396785..397258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00334"
FT                   /product="hypothetical protein"
FT                   /note="COG2128 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03455"
FT                   /db_xref="GOA:D7BYC7"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC7"
FT                   /protein_id="ADI03455.1"
FT                   /translation="MDARLNYFTIPAAGKALKYFMSAGKELKDMPLPAATQELVALRVS
FT                   QINGCAVCIDMHTKEATAAGETPVRLNLVAAWREATVFTEAERAALALAEEGTRVADAA
FT                   HGVSDETWAQAATHYDQEQLTALVILVSFMNSVNRLNIITQQPAGNYQAGQFH"
     MDARLNYFTI PAAGKALKYF MSAGKELKDM PLPAATQELV ALRVSQINGC AVCIDMHTKE        60
     ATAAGETPVR LNLVAAWREA TVFTEAERAA LALAEEGTRV ADAAHGVSDE TWAQAATHYD       120
     QEQLTALVIL VSFMNSVNRL NIITQQPAGN YQAGQFH                                157
//

If you have problems or comments...

PBIL Back to PBIL home page