(data stored in ACNUC7421 zone)

EMBL: CP002047.PE335

CP002047.PE335       Location/Qualifiers
FT   CDS             complement(397383..399056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00335"
FT                   /product="cytochrome B subunit"
FT                   /note="COG1290 Cytochrome b subunit of the bc complex"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03456"
FT                   /db_xref="GOA:D7BYC8"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYC8"
FT                   /protein_id="ADI03456.1"
FT                   /translation="MDNCALEPAAQEIAEATANAGRSTEPQRGRRGEKVAEWTRGRLGV
FT                   RNLTRAGMRKAFPDHWSFMLGEICLYSFLIVIATGIYLSLYFHPTMNQVEYRGSYLPLR
FT                   GQMVSEAFDSTMHISFDVRGGLLIRQAHHWAALIFVAGIFVHMMRVFFTGAFRRPRELN
FT                   WVFGFLLLLLAMFAGLTGYDLPGDLLSGTGLVVVNGTLLSVPIVGTYLSMFLFGGEFPG
FT                   NDLVARFNAIHVLVIPGLMVGLIVAHLILVFRHKHTQYPGPGRTNRNVIGMPLRVHAVK
FT                   AAGYFFLVTGVIFVIASIAQINPIWEYGPYRPDQVSAGSQPDWYMGVADGLIRVMPGWE
FT                   ISIWGHTLALDNLIPLLAGVGLFLVMGAYPFIEAWVTDDDREHHLLDRPRNRPVRTGLG
FT                   AAWISVYLVALTGAGNDIIATQFHVSVNSVTWAVRIGLFLVPIAVYAVTKRWALGLQRR
FT                   DRDKVLHGRETGIIKRLPHGEFVEVHEPLSRERLHILTAHEQYQPIESGGPGVQGGPVR
FT                   STSRTRRLRARLSRGFYGEGTQIPKPTVQEYEEITSGHRR"
     MDNCALEPAA QEIAEATANA GRSTEPQRGR RGEKVAEWTR GRLGVRNLTR AGMRKAFPDH        60
     WSFMLGEICL YSFLIVIATG IYLSLYFHPT MNQVEYRGSY LPLRGQMVSE AFDSTMHISF       120
     DVRGGLLIRQ AHHWAALIFV AGIFVHMMRV FFTGAFRRPR ELNWVFGFLL LLLAMFAGLT       180
     GYDLPGDLLS GTGLVVVNGT LLSVPIVGTY LSMFLFGGEF PGNDLVARFN AIHVLVIPGL       240
     MVGLIVAHLI LVFRHKHTQY PGPGRTNRNV IGMPLRVHAV KAAGYFFLVT GVIFVIASIA       300
     QINPIWEYGP YRPDQVSAGS QPDWYMGVAD GLIRVMPGWE ISIWGHTLAL DNLIPLLAGV       360
     GLFLVMGAYP FIEAWVTDDD REHHLLDRPR NRPVRTGLGA AWISVYLVAL TGAGNDIIAT       420
     QFHVSVNSVT WAVRIGLFLV PIAVYAVTKR WALGLQRRDR DKVLHGRETG IIKRLPHGEF       480
     VEVHEPLSRE RLHILTAHEQ YQPIESGGPG VQGGPVRSTS RTRRLRARLS RGFYGEGTQI       540
     PKPTVQEYEE ITSGHRR                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page