(data stored in ACNUC7421 zone)

EMBL: CP002047.PE34

CP002047.PE34        Location/Qualifiers
FT   CDS             complement(32875..33417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03155"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX8"
FT                   /protein_id="ADI03155.1"
FT                   /translation="MDDKIWFIGLPYDDDRDASAPADQQCLAEVLEGQGFRTAPADFGP
FT                   SLEVWLPDPSEFAASVHLGDSWMVQIAVDERRLAEDFDEYRGNTDALAKLIGIVTEYAG
FT                   TYLGFVTADDDDDLSFMEEDPPVHLGQPLAMVYFGRRYLSGWPDEPQWAADPKARWELP
FT                   TGVLLVPASSPLEITRA"
     MDDKIWFIGL PYDDDRDASA PADQQCLAEV LEGQGFRTAP ADFGPSLEVW LPDPSEFAAS        60
     VHLGDSWMVQ IAVDERRLAE DFDEYRGNTD ALAKLIGIVT EYAGTYLGFV TADDDDDLSF       120
     MEEDPPVHLG QPLAMVYFGR RYLSGWPDEP QWAADPKARW ELPTGVLLVP ASSPLEITRA       180
//

If you have problems or comments...

PBIL Back to PBIL home page