(data stored in ACNUC7421 zone)

EMBL: CP002047.PE340

CP002047.PE340       Location/Qualifiers
FT   CDS             402315..402503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03461"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD3"
FT                   /protein_id="ADI03461.1"
FT                   /translation="MMPRDAHQHSDPAAACVSLAAEAALLEARLQMLQEAIDTVDTRIK
FT                   SVSDALRHTRPAGAAGC"
     MMPRDAHQHS DPAAACVSLA AEAALLEARL QMLQEAIDTV DTRIKSVSDA LRHTRPAGAA        60
     GC                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page