(data stored in ACNUC7421 zone)

EMBL: CP002047.PE342

CP002047.PE342       Location/Qualifiers
FT   CDS             404107..404571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00342"
FT                   /product="hypothetical protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03463"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD5"
FT                   /protein_id="ADI03463.1"
FT                   /translation="MYSGSSGEINANFRPASTAPNVGTAGRDAIHYLATTATTRGEFGL
FT                   YRVEMSAKAGGPNTHFHKSISESFFILDGTVRLFNGAEWIDGQKGDFLHVPQGGLHAFR
FT                   NDSDAPAEMLLLFTPGAPREEYFEGLSQLADATDEERAEFFVRHDSYFVE"
     MYSGSSGEIN ANFRPASTAP NVGTAGRDAI HYLATTATTR GEFGLYRVEM SAKAGGPNTH        60
     FHKSISESFF ILDGTVRLFN GAEWIDGQKG DFLHVPQGGL HAFRNDSDAP AEMLLLFTPG       120
     APREEYFEGL SQLADATDEE RAEFFVRHDS YFVE                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page