(data stored in ACNUC7421 zone)

EMBL: CP002047.PE344

CP002047.PE344       Location/Qualifiers
FT   CDS             complement(406114..406767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03465"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD7"
FT                   /protein_id="ADI03465.1"
FT                   /translation="MVSVAHTAQSIEITAENLQEELRRLEVQRQALERELAAVVAHLGS
FT                   VRTTLNALQDLMQVATLASGEAAVGVAVPKPVRAKVTEAVEPTPSGPTPSGPAPAPDGA
FT                   AVVRAEPEARPQRPEGQQKQQKQQKQQKPARTARRGERGDRQTDGKYGRLTEQIMDFFA
FT                   GTGGADVRARDVAAALGRDTDAGSINAVRSTLDRLVATSRVQRAGRGLYRANPS"
     MVSVAHTAQS IEITAENLQE ELRRLEVQRQ ALERELAAVV AHLGSVRTTL NALQDLMQVA        60
     TLASGEAAVG VAVPKPVRAK VTEAVEPTPS GPTPSGPAPA PDGAAVVRAE PEARPQRPEG       120
     QQKQQKQQKQ QKPARTARRG ERGDRQTDGK YGRLTEQIMD FFAGTGGADV RARDVAAALG       180
     RDTDAGSINA VRSTLDRLVA TSRVQRAGRG LYRANPS                                217
//

If you have problems or comments...

PBIL Back to PBIL home page