(data stored in ACNUC7421 zone)

EMBL: CP002047.PE345

CP002047.PE345       Location/Qualifiers
FT   CDS             complement(406923..407381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00345"
FT                   /product="secreted protein"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03466"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD8"
FT                   /protein_id="ADI03466.1"
FT                   /translation="MKIAVIGGTGLIGSQVVKKLNTVGHEAVPHSKSTGVDVITGEGVA
FT                   DAVADADVIVSLTNSPTFDEASAVFFRKSMGNLLTAGEKAGVRHFAGPEVFPLDELGRI
FT                   TLAARSDGRTVMTDDTAGMFALVRGDVLTGKEDARLAPTRYADWLASR"
     MKIAVIGGTG LIGSQVVKKL NTVGHEAVPH SKSTGVDVIT GEGVADAVAD ADVIVSLTNS        60
     PTFDEASAVF FRKSMGNLLT AGEKAGVRHF AGPEVFPLDE LGRITLAARS DGRTVMTDDT       120
     AGMFALVRGD VLTGKEDARL APTRYADWLA SR                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page